DR6/TNFRSF21 Antibody

Images

 
Western Blot: DR6 Antibody [NBP1-84982] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: DR6 Antibody [NBP1-84982] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: DR6 Antibody [NBP1-84982] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DR6/TNFRSF21 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTLPSFSSSTS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFRSF21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DR6/TNFRSF21 Protein (NBP1-84982PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DR6/TNFRSF21 Antibody

  • BM-018
  • CD358 antigen
  • CD358
  • Death receptor 6
  • DR6
  • DR6TNFR-related death receptor 6
  • MGC31965
  • TNFRSF21
  • tumor necrosis factor receptor superfamily member 21
  • tumor necrosis factor receptor superfamily, member 21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00001810-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-84982
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DR6/TNFRSF21 Antibody (NBP1-84982) (0)

There are no publications for DR6/TNFRSF21 Antibody (NBP1-84982).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DR6/TNFRSF21 Antibody (NBP1-84982) (0)

There are no reviews for DR6/TNFRSF21 Antibody (NBP1-84982). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DR6/TNFRSF21 Antibody (NBP1-84982) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DR6/TNFRSF21 Products

Bioinformatics Tool for DR6/TNFRSF21 Antibody (NBP1-84982)

Discover related pathways, diseases and genes to DR6/TNFRSF21 Antibody (NBP1-84982). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DR6/TNFRSF21 Antibody (NBP1-84982)

Discover more about diseases related to DR6/TNFRSF21 Antibody (NBP1-84982).
 

Pathways for DR6/TNFRSF21 Antibody (NBP1-84982)

View related products by pathway.

PTMs for DR6/TNFRSF21 Antibody (NBP1-84982)

Learn more about PTMs related to DR6/TNFRSF21 Antibody (NBP1-84982).
 

Research Areas for DR6/TNFRSF21 Antibody (NBP1-84982)

Find related products by research area.

Blogs on DR6/TNFRSF21

There are no specific blogs for DR6/TNFRSF21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DR6/TNFRSF21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF21
Entrez
Uniprot