DPP10 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DPP10 Antibody [NBP2-13936] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus & vesicles.

Immunohistochemistry-Paraffin: DPP10 Antibody [NBP2-13936] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neuronal cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DPP10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GLLNRQCISCNFMKEQCTYFDASFSPMNQHFLLFCEGPRVPVVSLHSTDNPAKYFILESNSMLKEAILKKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPP10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DPP10 Protein (NBP2-13936PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DPP10 Antibody - BSA Free

• dipeptidyl peptidase 10
• Dipeptidyl peptidase IV-related protein 3
• dipeptidyl peptidase like protein 2
• Dipeptidyl peptidase X
• Dipeptidyl peptidase-like protein 2
• dipeptidyl-peptidase 10 (non-functional)
• dipeptidyl-peptidase 10
• DPL2
• DPP X
• DPP10
• DPPY
• DPRP3
• DPRP-3
• DPRP3dipeptidylpeptidase 10
• inactive dipeptidyl peptidase 10
• KIAA1492

Background

DPP10 is a novel gene, DPP10, encodes a homolog of dipeptidyl peptidases (DPPs) that cleave terminal dipeptides from cytokines and chemokines, and it presents a potential new target for asthma therapy. The DPP10 protein shares features with members of the S9B family of DPP serine proteases, which includes DPP4, a widely expressed enzyme that plays a central role in chemokine processing as part of the innate immune system. The locus displays a complex pattern of transcript splicing, with eight alternate first exons; four of which localize within the LD block strongly associated with asthma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPP10