DPP10 Antibody


Immunocytochemistry/ Immunofluorescence: DPP10 Antibody [NBP2-13936] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus & vesicles.
Immunohistochemistry-Paraffin: DPP10 Antibody [NBP2-13936] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: DPP10 Antibody [NBP2-13936] - Staining of human duodenum shows distinct positivity in plasma.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

DPP10 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GLLNRQCISCNFMKEQCTYFDASFSPMNQHFLLFCEGPRVPVVSLHSTDN PAKYFILESNSMLKEAILKKK
Specificity of human DPP10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DPP10 Protein (NBP2-13936PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (82%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DPP10 Antibody

  • dipeptidyl peptidase 10
  • Dipeptidyl peptidase IV-related protein 3
  • dipeptidyl peptidase like protein 2
  • Dipeptidyl peptidase X
  • Dipeptidyl peptidase-like protein 2
  • dipeptidyl-peptidase 10 (non-functional)
  • dipeptidyl-peptidase 10
  • DPL2
  • DPP X
  • DPP10
  • DPPY
  • DPRP3
  • DPRP-3
  • DPRP3dipeptidylpeptidase 10
  • inactive dipeptidyl peptidase 10
  • KIAA1492


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IP, CyTOF-ready, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DPP10 Antibody (NBP2-13936) (0)

There are no publications for DPP10 Antibody (NBP2-13936).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPP10 Antibody (NBP2-13936) (0)

There are no reviews for DPP10 Antibody (NBP2-13936). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DPP10 Antibody (NBP2-13936) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DPP10 Products

Bioinformatics Tool for DPP10 Antibody (NBP2-13936)

Discover related pathways, diseases and genes to DPP10 Antibody (NBP2-13936). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPP10 Antibody (NBP2-13936)

Discover more about diseases related to DPP10 Antibody (NBP2-13936).

Pathways for DPP10 Antibody (NBP2-13936)

View related products by pathway.

PTMs for DPP10 Antibody (NBP2-13936)

Learn more about PTMs related to DPP10 Antibody (NBP2-13936).

Blogs on DPP10

There are no specific blogs for DPP10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DPP10 Antibody and receive a gift card or discount.


Gene Symbol DPP10