DPH5 Antibody

Images

 
Western Blot: DPH5 Antibody [NBP2-87300] - Host: Rabbit. Target Name: DPH5. Sample Tissue: Human Mesenchymoma Tumor lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPH5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DPH5. Peptide sequence: QLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DPH5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DPH5 Antibody

  • CGI-30
  • Diphthamide biosynthesis methyltransferase
  • diphthine synthase
  • DPH5 homolog (S. cerevisiae)
  • EC 2.1.1.98
  • HSPC143
  • MGC61450
  • NPD015
  • protein x 0011

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16866
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84276
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-56693
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03732
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-86893
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87969
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32448
Species: Hu
Applications: ICC/IF, WB
NBP2-16321
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-86687
Species: Hu
Applications: IHC, IHC-P, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-82648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-30620
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85250
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single-Cell Western, WB
NBP1-87964
Species: Hu
Applications: IHC, IHC-P
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-98959
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, WB
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-87300
Species: Hu
Applications: WB

Publications for DPH5 Antibody (NBP2-87300) (0)

There are no publications for DPH5 Antibody (NBP2-87300).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPH5 Antibody (NBP2-87300) (0)

There are no reviews for DPH5 Antibody (NBP2-87300). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPH5 Antibody (NBP2-87300) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPH5 Products

Bioinformatics Tool for DPH5 Antibody (NBP2-87300)

Discover related pathways, diseases and genes to DPH5 Antibody (NBP2-87300). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPH5 Antibody (NBP2-87300)

Discover more about diseases related to DPH5 Antibody (NBP2-87300).
 

Pathways for DPH5 Antibody (NBP2-87300)

View related products by pathway.

PTMs for DPH5 Antibody (NBP2-87300)

Learn more about PTMs related to DPH5 Antibody (NBP2-87300).
 

Research Areas for DPH5 Antibody (NBP2-87300)

Find related products by research area.

Blogs on DPH5

There are no specific blogs for DPH5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPH5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPH5