DPH5 Antibody

Images

 
Immunohistochemistry-Paraffin: DPH5 Antibody [NBP2-13934] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPH5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVNQAAQQLLEIVQNQRIRGEEPAVTEETLCVGLARVGADDQKIAAGTLR QMCTVDLGEPLHSLIITGGSIHPMEMEMLSLFSIPENSSESQSING
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPH5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DPH5 Protein (NBP2-13934PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DPH5 Antibody

  • CGI-30
  • Diphthamide biosynthesis methyltransferase
  • diphthine synthase
  • DPH5 homolog (S. cerevisiae)
  • EC 2.1.1.98
  • HSPC143
  • MGC61450
  • NPD015
  • protein x 0011

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-84276
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-56693
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-03732
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87969
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85002
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16321
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30620
Species: Hu
Applications: IHC, IHC-P
NBP1-85250
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59312
Species: Hu
Applications: WB
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13934
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DPH5 Antibody (NBP2-13934) (0)

There are no publications for DPH5 Antibody (NBP2-13934).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPH5 Antibody (NBP2-13934) (0)

There are no reviews for DPH5 Antibody (NBP2-13934). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPH5 Antibody (NBP2-13934) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPH5 Products

Bioinformatics Tool for DPH5 Antibody (NBP2-13934)

Discover related pathways, diseases and genes to DPH5 Antibody (NBP2-13934). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPH5 Antibody (NBP2-13934)

Discover more about diseases related to DPH5 Antibody (NBP2-13934).
 

Pathways for DPH5 Antibody (NBP2-13934)

View related products by pathway.

PTMs for DPH5 Antibody (NBP2-13934)

Learn more about PTMs related to DPH5 Antibody (NBP2-13934).
 

Research Areas for DPH5 Antibody (NBP2-13934)

Find related products by research area.

Blogs on DPH5

There are no specific blogs for DPH5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPH5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPH5