DORFIN Antibody - BSA Free Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCL |
Predicted Species |
Mouse (98%), Rat (93%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
RNF19A |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for DORFIN Antibody - BSA Free
Background
Dorfin is an E3 ubiquitin ligase which mediates ubiquitination of cellular proteins. Dorfin contains two RING-finger motifs and an IBR (in between RING fingers) motif. Dorfin interacts with UBE2L3/UBCH7 and UBE2E2/UBCH8, but not other ubiquitin-conjugating enzymes. Dorfin is of interest in Parkinson's Disease, as it binds and ubiquitylates synphilin 1 (SNCAIP - interacts with alpha synuclein) in neurons. Furthermore, Dorfin expression is increased in Lewy bodies, the characteristic neuronal inclusions in Parkinson's diseased brains. In normal subjects, Dorfin is widely expressed at low levels with higher levels found in the heart and is ubiquitously expressed in the central nervous system. Alternatively spliced transcript variants encoding the same protein have been reported.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: EnzAct
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for DORFIN Antibody (NBP1-87989) (0)
There are no publications for DORFIN Antibody (NBP1-87989).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DORFIN Antibody (NBP1-87989) (0)
There are no reviews for DORFIN Antibody (NBP1-87989).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DORFIN Antibody (NBP1-87989) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DORFIN Products
Research Areas for DORFIN Antibody (NBP1-87989)
Find related products by research area.
|
Blogs on DORFIN