![Western Blot: DOK3 Antibody [NBP2-62717] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://images.novusbio.com/fullsize/DOK3-Antibody-Western-Blot-NBP2-62717-img0004.jpg "Western Blot: DOK3 Antibody [NBP2-62717] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit DOK3 Antibody - BSA Free (NBP2-62717) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRER |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DOK3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Western Blot DOK1 [p Tyr362] Antibody - BSA Free](https://images.novusbio.com/images/DOK1-[p-Tyr362]-Antibody-Western-Blot-NB100-82112-img0001.jpg)
![Immunohistochemistry-Paraffin DOK1 [p Tyr362] Antibody - BSA Free](https://images.novusbio.com/images/nb100-82112_rabbit-polyclonal-dok1-p-tyr362-antibody-103202523464515.jpg)
![Western Blot DOK1 [p Tyr362] Antibody - BSA Free](https://images.novusbio.com/images/DOK1-[p-Tyr362]-Antibody-Western-Blot-NB100-82112-img0004.jpg)
![Western Blot SHIP Antibody (257812) [Unconjugated]](https://images.novusbio.com/images2/SHIP_MAB2317_Western_Blot_6027.jpg)
![Immunocytochemistry SHIP Antibody (257812) [Unconjugated]](https://images.novusbio.com/images2/SHIP_MAB2317_Immunocytochemistry_9852.jpg)
![Knockout Validated SHIP Antibody (257812) [Unconjugated]](https://images.novusbio.com/images/mab2317_human-mouse-rat-ship-mab-clone-257812-20820241518568.jpg)
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DOK3 |
![Immunohistochemistry-Paraffin: DOK3 Antibody [NBP2-62717] - Staining of human cerebral cortex shows low expression as expected.](http://images.novusbio.com/fullsize/DOK3-Antibody-Immunohistochemistry-Paraffin-NBP2-62717-img0003.jpg "Immunohistochemistry-Paraffin: DOK3 Antibody [NBP2-62717] - Staining of human cerebral cortex shows low expression as expected.")
![Immunohistochemistry-Paraffin: DOK3 Antibody [NBP2-62717] - Analysis in human lymph node and cerebral cortex tissues using Anti-DOK3 antibody. Corresponding DOK3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DOK3-Antibody-Immunohistochemistry-Paraffin-NBP2-62717-img0001.jpg "Immunohistochemistry-Paraffin: DOK3 Antibody [NBP2-62717] - Analysis in human lymph node and cerebral cortex tissues using Anti-DOK3 antibody. Corresponding DOK3 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: DOK3 Antibody [NBP2-62717] - Staining of human lymph node shows high expression.](http://images.novusbio.com/fullsize/DOK3-Antibody-Immunohistochemistry-Paraffin-NBP2-62717-img0002.jpg "Immunohistochemistry-Paraffin: DOK3 Antibody [NBP2-62717] - Staining of human lymph node shows high expression.")
![Western Blot GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Western_Blot_5355.jpg)
![Immunohistochemistry GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Immunohistochemistry_6809.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")