DOK2 Antibody - BSA Free

Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652] - Staining of human lymph node shows high expression.

Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652] - Analysis in human lymph node and skeletal muscle tissues using Anti-DOK2 antibody. Corresponding DOK2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DOK2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DOK2 Antibody - BSA Free (NBP2-62652) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DOK2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DOK2 Recombinant Protein Antigen (NBP2-62652PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for DOK2 Antibody - BSA Free

• docking protein 2
• docking protein 2, 56kD
• docking protein 2, 56kDa
• Dok-2
• Downstream of tyrosine kinase 2
• p56(dok-2)
• p56DOK
• p56dok-2

Background

Docking proteins interact with receptor tyrosine kinases and mediate particular biological responses using signal transduction. DOK2 acts as a multiple docking protein downstream of receptor or non-receptor tyrosine kinases. By this mechanism it acts to negatively regulate signal transduction and cell proliferation controlled by cytokines in a feedback loop. DOK2 is highly expressed in cells and tissues of hematopoietic origin as well as in lung. Expression of bcr/abl induces additional tyrosine phosphorylation of the DOK1 and DOK2 proteins and their association with Ras-GAP. Thus, it is suspected that DOK association regulates GAP activity toward Ras and that the DOK proteins serve as mediators of bcr-abl signaling. The role of DOK proteins in bcr-abl regulation may also be implicated in chronic myelogenous leukemia (CML), which is characterized by a Philadelphia chromosome translocation t(9;22). Such a mutation would result in a p210-bcr/abl chimeric protein-tyrosine kinase which has been found in many CML cases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DOK2