DOK2 Antibody

Images

 
Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652] - Analysis in human lymph node and skeletal muscle tissues using Anti-DOK2 antibody. Corresponding DOK2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DOK2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DOK2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DOK2 Recombinant Protein Antigen (NBP2-62652PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for DOK2 Antibody

  • docking protein 2
  • docking protein 2, 56kD
  • docking protein 2, 56kDa
  • Dok-2
  • Downstream of tyrosine kinase 2
  • p56(dok-2)
  • p56DOK
  • p56dok-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-82112
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80507
Species: Hu
Applications: WB
AF5094
Species: Hu, Mu, Rt
Applications: WB
AF2554
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-84084
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2317
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46218
Species: Hu
Applications: WB, IHC
NBP2-75585
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-02340
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2724
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-62652
Species: Hu
Applications: IHC, IHC-P

Publications for DOK2 Antibody (NBP2-62652) (0)

There are no publications for DOK2 Antibody (NBP2-62652).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOK2 Antibody (NBP2-62652) (0)

There are no reviews for DOK2 Antibody (NBP2-62652). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DOK2 Antibody (NBP2-62652) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DOK2 Antibody (NBP2-62652)

Discover related pathways, diseases and genes to DOK2 Antibody (NBP2-62652). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOK2 Antibody (NBP2-62652)

Discover more about diseases related to DOK2 Antibody (NBP2-62652).
 

Pathways for DOK2 Antibody (NBP2-62652)

View related products by pathway.

PTMs for DOK2 Antibody (NBP2-62652)

Learn more about PTMs related to DOK2 Antibody (NBP2-62652).
 

Research Areas for DOK2 Antibody (NBP2-62652)

Find related products by research area.

Blogs on DOK2

There are no specific blogs for DOK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DOK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DOK2