DOK1 Antibody (6U4U9) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 382-481 of human DOK1 (Q99704). EPKDAWWCQARVKEEGYELPYNPATDDYAVPPPRSTKPLLAPKPQGPAFPEPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
DOK1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for DOK1 Antibody (6U4U9)
Background
Dok-1 associates with the Ras GTPase-activating protein (Ras GAP) upon tyrosine phosphorylation. Evidence suggests that Dok-1 (also designated p62dok) is a substrate of the constitutive tyrosine kinase activity of p210 Bcr-Abl, a fusion protein caused by the t(9;22) translocation and associated with chronic myelogenous leukemia. Dok-1, as well as the tyrosine kinase substrates IRS-1 and Cas, are members of a class of "docking" proteins which contain multiple tyrosine residues and putative SH2 binding sites. Dok-1 is suspected to be the substrate phosphorylated in response to stimulation by a number of growth factors, including PDGF, VEGF, insulin and IGF. Dok-2 (also designated p56dok) has also been identified as a potential mediator of the effects of p210 Bcr-Abl.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Pm, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Publications for DOK1 Antibody (NBP3-15713) (0)
There are no publications for DOK1 Antibody (NBP3-15713).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DOK1 Antibody (NBP3-15713) (0)
There are no reviews for DOK1 Antibody (NBP3-15713).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DOK1 Antibody (NBP3-15713) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DOK1 Products
Research Areas for DOK1 Antibody (NBP3-15713)
Find related products by research area.
|
Blogs on DOK1