DOCK4 Antibody (1B3) Summary
Immunogen |
DOCK4 (NP_055520, 1867 a.a. ~ 1966 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLPRKVSQL |
Specificity |
DOCK4 - dedicator of cytokinesis 4 (1B3) |
Isotype |
IgG3 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
DOCK4 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500
- ELISA
- Sandwich ELISA
|
Application Notes |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for DOCK4 Antibody (1B3)
Background
This gene is a member of the dedicator of cytokinesis (DOCK) family and encodes a protein with a DHR-1 (CZH-1) domain, a DHR-2 (CZH-2) domain and an SH3 domain. This membrane-associated, cytoplasmic protein functions as a guanine nucleotide exchange factor and is involved in regulation of adherens junctions between cells. Mutations in this gene have been associated with ovarian, prostate, glioma, and colorectal cancers. Alternatively spliced variants which encode different protein isoforms have been described, but only one has been fully characterized. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, S-ELISA
Publications for DOCK4 Antibody (H00009732-M03) (0)
There are no publications for DOCK4 Antibody (H00009732-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DOCK4 Antibody (H00009732-M03) (0)
There are no reviews for DOCK4 Antibody (H00009732-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DOCK4 Antibody (H00009732-M03) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional DOCK4 Products
Bioinformatics Tool for DOCK4 Antibody (H00009732-M03)
Discover related pathways, diseases and genes to DOCK4 Antibody (H00009732-M03). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for DOCK4 Antibody (H00009732-M03)
Discover more about diseases related to DOCK4 Antibody (H00009732-M03).
| | Pathways for DOCK4 Antibody (H00009732-M03)
View related products by pathway.
|
PTMs for DOCK4 Antibody (H00009732-M03)
Learn more about PTMs related to DOCK4 Antibody (H00009732-M03).
|
Blogs on DOCK4