DOCK4 Antibody (1B3)

Images

 
Western Blot: DOCK4 Antibody (1B3) [H00009732-M03] - DOCK4 monoclonal antibody (M03), clone 1B3. Western Blot analysis of DOCK4 expression in PC-12 ( Cat # L012V1 ).
ELISA: DOCK4 Antibody (1B3) [H00009732-M03] - Detection limit for recombinant GST tagged DOCK4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DOCK4 Antibody (1B3) Summary

Immunogen
DOCK4 (NP_055520, 1867 a.a. ~ 1966 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLPRKVSQL
Specificity
DOCK4 - dedicator of cytokinesis 4 (1B3)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DOCK4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DOCK4 Antibody (1B3)

  • dedicator of cytokinesis 4
  • dedicator of cytokinesis protein 4
  • KIAA0716FLJ34238
  • MGC134911
  • MGC134912

Background

This gene is a member of the dedicator of cytokinesis (DOCK) family and encodes a protein with a DHR-1 (CZH-1) domain, a DHR-2 (CZH-2) domain and an SH3 domain. This membrane-associated, cytoplasmic protein functions as a guanine nucleotide exchange factor and is involved in regulation of adherens junctions between cells. Mutations in this gene have been associated with ovarian, prostate, glioma, and colorectal cancers. Alternatively spliced variants which encode different protein isoforms have been described, but only one has been fully characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-30945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF7134
Species: Hu
Applications: IHC
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
NBP2-22527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89189
Species: Hu, Mu
Applications: IHC, IHC-P
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-21065
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
H00009732-M03
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for DOCK4 Antibody (H00009732-M03) (0)

There are no publications for DOCK4 Antibody (H00009732-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOCK4 Antibody (H00009732-M03) (0)

There are no reviews for DOCK4 Antibody (H00009732-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DOCK4 Antibody (H00009732-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DOCK4 Products

Array H00009732-M03

Bioinformatics Tool for DOCK4 Antibody (H00009732-M03)

Discover related pathways, diseases and genes to DOCK4 Antibody (H00009732-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOCK4 Antibody (H00009732-M03)

Discover more about diseases related to DOCK4 Antibody (H00009732-M03).
 

Pathways for DOCK4 Antibody (H00009732-M03)

View related products by pathway.

PTMs for DOCK4 Antibody (H00009732-M03)

Learn more about PTMs related to DOCK4 Antibody (H00009732-M03).

Blogs on DOCK4

There are no specific blogs for DOCK4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DOCK4 Antibody (1B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol DOCK4
Entrez
Uniprot