Recombinant Human DNASE2B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DNASE2B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-153 of Human DNASE2B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPQLCTRASSSEIPGRLLTTLQSAQGQKFLHFAKSDSFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
DNASE2B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DNASE2B Protein

  • deoxyribonuclease II betaDNase2-like acid DNase
  • DLADdeoxyribonuclease-2-beta
  • DNase II beta
  • DNase II-like acid DNase
  • EC 3.1.22.1
  • Endonuclease DLAD
  • lysosomal DNase II

Background

The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this gene product is restricted to the salivary gland and lungs. The gene has been localized to chromosome 1p22.3 adjacent (and in opposite orientation) to the uricase pseudogene. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13592
Species: Hu
Applications: WB
NBP1-76971
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
MAB2520
Species: Mu
Applications: WB, IHC, IP
AF6235
Species: Hu
Applications: WB
MAB5457
Species: Hu, Mu, Rt
Applications: WB
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-03828
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB600-934
Species: Ba
Applications: WB, ELISA, IP
NBP1-90320
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76471
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
AF2727
Species: Hu
Applications: WB, Simple Western, ICC
H00058511-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for DNASE2B Recombinant Protein (H00058511-P01) (0)

There are no publications for DNASE2B Recombinant Protein (H00058511-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNASE2B Recombinant Protein (H00058511-P01) (0)

There are no reviews for DNASE2B Recombinant Protein (H00058511-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNASE2B Recombinant Protein (H00058511-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNASE2B Products

Bioinformatics Tool for DNASE2B Recombinant Protein (H00058511-P01)

Discover related pathways, diseases and genes to DNASE2B Recombinant Protein (H00058511-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNASE2B Recombinant Protein (H00058511-P01)

Discover more about diseases related to DNASE2B Recombinant Protein (H00058511-P01).

Research Areas for DNASE2B Recombinant Protein (H00058511-P01)

Find related products by research area.

Blogs on DNASE2B

There are no specific blogs for DNASE2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
DNASE2B Antibody
NBP2-16199

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DNASE2B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DNASE2B