DNAJC3 Antibody (4D3-F2)

Images

 
Immunocytochemistry/ Immunofluorescence: DNAJC3 Antibody (4D3-F2) [H00005611-M01] - Analysis of monoclonal antibody to DNAJC3 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4D3-F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DNAJC3 Antibody (4D3-F2) Summary

Immunogen
DNAJC3 (AAH33823, 1 a.a. ~ 234 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKKVTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSCLRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS
Marker
ER Stress Marker
Specificity
DNAJC3 - DnaJ (Hsp40) homolog, subfamily C, member 3
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DNAJC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IF and ELISA.
Publications
Read Publication using H00005611-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNAJC3 Antibody (4D3-F2)

  • DnaJ (Hsp40) homolog, subfamily C, member 3
  • HP58
  • Interferon-induced, double-stranded RNA-activated protein kinase inhibitor
  • P58FLJ21288
  • P58IPKProtein kinase inhibitor p58
  • PRKRIdnaJ homolog subfamily C member 3
  • Protein kinase inhibitor of 58 kDa
  • protein-kinase, interferon-inducible double stranded RNA dependent inhibitor

Background

The protein encoded by this gene contains multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP1-06274
Species: Hu, Mu, Rt, Ce, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IHC-FrFl
NBP2-61871
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-03381
Species: Hu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, ChIP
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB100-496
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00001523-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-19151
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-86684
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for DNAJC3 Antibody (H00005611-M01)(1)

Reviews for DNAJC3 Antibody (H00005611-M01) (0)

There are no reviews for DNAJC3 Antibody (H00005611-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNAJC3 Antibody (H00005611-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DNAJC3 Products

Bioinformatics Tool for DNAJC3 Antibody (H00005611-M01)

Discover related pathways, diseases and genes to DNAJC3 Antibody (H00005611-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC3 Antibody (H00005611-M01)

Discover more about diseases related to DNAJC3 Antibody (H00005611-M01).
 

Pathways for DNAJC3 Antibody (H00005611-M01)

View related products by pathway.

PTMs for DNAJC3 Antibody (H00005611-M01)

Learn more about PTMs related to DNAJC3 Antibody (H00005611-M01).
 

Research Areas for DNAJC3 Antibody (H00005611-M01)

Find related products by research area.

Blogs on DNAJC3

There are no specific blogs for DNAJC3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC3 Antibody (4D3-F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC3
Entrez
OMIM