DNAJC12 Antibody (1A3U8)

Western Blot: DNAJC12 Antibody (1A3U8) [NBP3-33236] - Western blot analysis of lysates from Mouse pancreas, using DNAJC12 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Mu
• Applications: WB, ELISA
• Clone: 1A3U8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

DNAJC12 Antibody (1A3U8) Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 99-198 of human DNAJC12 (Q9UKB3).
  
  Sequence:
  TSMHWVVRGKKDLMLEESDKTHTTKMENEECNEQRERKKEELASTAEKTEQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYEI
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: DNAJC12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DNAJC12 Antibody (1A3U8)

• DnaJ (Hsp40) homolog, subfamily C, member 12
• dnaJ homolog subfamily C member 12
• J domain containing protein 1 (JDP1)
• J domain protein 1
• JDP1J domain-containing protein 1

Background

The DNAJC12 gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins areassociated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms havebeen identified for this

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAJC12