DNAJB12 Recombinant Protein Antigen

Images

 
There are currently no images for DNAJB12 Recombinant Protein Antigen (NBP3-17700PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DNAJB12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAJB12

Source: E. coli

Amino Acid Sequence: PPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DNAJB12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17700.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNAJB12 Recombinant Protein Antigen

  • DJ10FLJ20027
  • DKFZp586B2023
  • DnaJ (Hsp40) homolog, subfamily B, member 12
  • dnaJ homolog subfamily B member 12
  • FLJ0027

Background

DNAJB12, also known as DnaJ homolog subfamily B member 12, consists of a 41.8 kDa and a 42.3 kDa isoform and is involved in stimulating ATPase in order to regulate molecular chaperone activity as a part of the DNAJ/HSP40 family. Diseases and disorders such as malaria, fundus dystrophy, choroiditis, choroideremia, and cone-rod dystrophy have been studied with the protein. The protein acts in the protein processing pathway in the endoplasmic reticulum along with MME, MYC, HSPA2, TNFRSF1A, and WIPI2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-02996
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00003304-M02
Species: Bv, Hu, Mu, Po, Rt
Applications: DB, ELISA, ICC/IF, IHC,  IHC-P, PLA, WB
H00010049-M01
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
AF796
Species: Mu
Applications: AdBlk, IHC, WB
AF1213
Species: Mu
Applications: Block, ICC, IHC, WB
NBP1-82240
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-87015
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-31756
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00055466-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-86920
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-48704
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-47990
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
DYC1663-2
Species: Hu, Mu, Rt
Applications: ELISA
DY870-05
Species: Hu
Applications: ELISA
NBP1-88019
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB

Publications for DNAJB12 Recombinant Protein Antigen (NBP3-17700PEP) (0)

There are no publications for DNAJB12 Recombinant Protein Antigen (NBP3-17700PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJB12 Recombinant Protein Antigen (NBP3-17700PEP) (0)

There are no reviews for DNAJB12 Recombinant Protein Antigen (NBP3-17700PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNAJB12 Recombinant Protein Antigen (NBP3-17700PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNAJB12 Products

Research Areas for DNAJB12 Recombinant Protein Antigen (NBP3-17700PEP)

Find related products by research area.

Blogs on DNAJB12

There are no specific blogs for DNAJB12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNAJB12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJB12