DNAJB11 Recombinant Protein Antigen

Images

 
There are currently no images for DNAJB11 Protein (NBP1-84900PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DNAJB11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAJB11.

Source: E. coli

Amino Acid Sequence: DSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DNAJB11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84900.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNAJB11 Recombinant Protein Antigen

  • ABBP-2
  • APOBEC1-binding protein 2
  • DnaJ (Hsp40) homolog, subfamily B, member 11
  • dnaJ homolog subfamily B member 11
  • DnaJ protein homolog 9
  • EDJABBP2
  • ER-associated dnaJ protein 3
  • ER-associated DNAJ
  • ER-associated Hsp40 co-chaperone
  • ERdj3DJ9
  • ERJ3
  • ERj3p
  • hDj9
  • hDj-9
  • HEDJERj3
  • Human DnaJ protein 9
  • PRO1080
  • PWP1-interacting protein 4
  • UNQ537

Background

Members of the heat shock protein 40 (HSP 40) family of proteins all contain a highly conserved J domain that associates with HSP 70 and regulates the function of HSP 70 by activating its adenosine triphosphatase activity. ERdj3, an HSP 40 chaperone, is expressed in the ER lumen, where it interacts with BiP, a molecule involved in retrotranslocating proteins out of the ER. ERdj3 also associates with several other protein substrates, including unfolded light chains, a nonsecreted Ig light chain mutant and a VSV-G ts045 mutant. Shiga toxin (Stx) is a bacterial tool that enzymatically inactivates the 28S rRNA, inhibiting protein synthesis of infected cells. Stx also interacts with ERdj3 and Sec 61 to form a complex through which proteins are retrotranslocated to the cytoplasm. ERdj3 may play a role in the ER quality control system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF1543
Species: Hu
Applications: IHC, WB
NBP2-02996
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00010049-M01
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-78785
Species: Hu, Mu
Applications: Flow, ICC/IF, PEP-ELISA, WB
NB300-619
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-81735
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-48704
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16865
Species: Hu, Ze
Applications: ChIP, ICC/IF, IHC-WhMt, IHC,  IHC-P, IP, KO, WB
NBP2-75752
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-85002
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-87201
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-40256
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, Simple Western, WB
NBP1-77681
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-94505
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-34068
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90271
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for DNAJB11 Protein (NBP1-84900PEP) (0)

There are no publications for DNAJB11 Protein (NBP1-84900PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJB11 Protein (NBP1-84900PEP) (0)

There are no reviews for DNAJB11 Protein (NBP1-84900PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNAJB11 Protein (NBP1-84900PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNAJB11 Products

Research Areas for DNAJB11 Protein (NBP1-84900PEP)

Find related products by research area.

Blogs on DNAJB11

There are no specific blogs for DNAJB11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNAJB11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJB11