DNAH11 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: VEEMLCNSFRMSAQMNRIATHLEIKNYQNDMDNMLGLAEVRQEIMNRVVNVINKVLDFRNTLETHTYLWVDDRAEFMKHFLLYGHAVS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DNAH11 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50-1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for DNAH11 Antibody
Background
The DNAH11 gene encodes a member of the dynein heavy chain family. It is a microtubule-dependent motor ATPase and has been reported to be involved in the movement of respiratory cilia. Mutations in this gene have been implicated in causing Kartagener Syndrome (
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: Simple Western, WB
Publications for DNAH11 Antibody (NBP1-91843) (0)
There are no publications for DNAH11 Antibody (NBP1-91843).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DNAH11 Antibody (NBP1-91843) (0)
There are no reviews for DNAH11 Antibody (NBP1-91843).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for DNAH11 Antibody (NBP1-91843). (Showing 1 - 1 of 1 FAQ).
-
We would like to use the aforementioned Ab in immunofluorescence and WB studies. Is this Ab also available for use in IF? Is the ELISA and/or immunohistochemistry version also working in WB?
- No, this antibody has not been tested for use in an IF application by our lab. The antibody has been established for use in an immunohistochemistry application only. We have not tested it for immunofluorescence, Western blot or ELISA applications. We would recommend our Innovators Reward Program to you in instances such as this. Our Innovator's Reward is offered to reward researchers for testing new species and applications with our products. Please contact us at innovators@novusbio.com for more information.
Secondary Antibodies
| |
Isotype Controls
|
Additional DNAH11 Products
Blogs on DNAH11