DNAH11 Antibody

Immunohistochemistry-Paraffin: DNAH11 Antibody [NBP1-91843] - Staining of human lymph node shows no positivity in lymphoid cells as expected.

Immunohistochemistry-Paraffin: DNAH11 Antibody [NBP1-91843] - Staining of human fallopian tube shows moderate positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: DNAH11 Antibody [NBP1-91843] - Staining of human bronchus shows moderate positivity in cilia in respiratory epithelial cells.

Immunohistochemistry-Paraffin: DNAH11 Antibody [NBP1-91843] - Staining of human cerebellum shows no positivity in purkinje cells as expected.

Product Discontinued

DNAH11 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VEEMLCNSFRMSAQMNRIATHLEIKNYQNDMDNMLGLAEVRQEIMNRVVNVINKVLDFRNTLETHTYLWVDDRAEFMKHFLLYGHAVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAH11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DNAH11 Antibody

• Axonemal beta dynein heavy chain 11
• axonemal
• CILD7Dnahc11
• Ciliary dynein heavy chain 11
• DNAHBLFLJ30095
• DNAHC11FLJ37699
• DNHBL
• dynein, axonemal, heavy chain 11
• dynein, axonemal, heavy polypeptide 11
• dynein, ciliary, heavy chain 11

Background

The DNAH11 gene encodes a member of the dynein heavy chain family. It is a microtubule-dependent motor ATPase and has been reported to be involved in the movement of respiratory cilia. Mutations in this gene have been implicated in causing Kartagener Syndrome (

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for DNAH11 Antibody (NBP1-91843). (Showing 1 - 1 of 1 FAQ).

1. We would like to use the aforementioned Ab in immunofluorescence and WB studies. Is this Ab also available for use in IF? Is the ELISA and/or immunohistochemistry version also working in WB?
   • No, this antibody has not been tested for use in an IF application by our lab. The antibody has been established for use in an immunohistochemistry application only. We have not tested it for immunofluorescence, Western blot or ELISA applications. We would recommend our Innovators Reward Program to you in instances such as this. Our Innovator's Reward is offered to reward researchers for testing new species and applications with our products. Please contact us at innovators@novusbio.com for more information.

Bioinformatics

• Gene Symbol: DNAH11
• Entrez:
  • 8701(Human)
• Uniprot:
  • Q96DT5(Human)