DNA Primase large subunit Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DNA Primase large subunit. Peptide sequence: QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PRIM2 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
1 mg/ml |
| Purity |
Protein A purified |
Alternate Names for DNA Primase large subunit Antibody - BSA Free
Background
The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. The protein encoded by this gene is the large, 58 kDa primase subunit. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: Block, CyTOF-ready, Flow
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for DNA Primase large subunit Antibody (NBP2-84798) (0)
There are no publications for DNA Primase large subunit Antibody (NBP2-84798).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DNA Primase large subunit Antibody (NBP2-84798) (0)
There are no reviews for DNA Primase large subunit Antibody (NBP2-84798).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DNA Primase large subunit Antibody (NBP2-84798) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DNA Primase large subunit Products
Research Areas for DNA Primase large subunit Antibody (NBP2-84798)
Find related products by research area.
|
Blogs on DNA Primase large subunit