Home » DNA polymerase sigma » DNA polymerase sigma Antibodies » DNA polymerase sigma Antibody (2F8)

DNA polymerase sigma Antibody (2F8)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: DNA polymerase sigma Antibody (2F8) [H00011044-M01] - Analysis of POLS over-expressed 293 cell line, cotransfected with POLS Validated Chimera RNAi ( Cat # H00011044-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with POLS monoclonal antibody (M01), clone 2F8 (Cat # H00011044-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: DNA polymerase sigma Antibody (2F8) [H00011044-M01] - Analysis of POLS over-expressed 293 cell line, cotransfected with POLS Validated Chimera RNAi ( Cat # H00011044-R01V ) (Lane 2) or non-transfected ...read more
Western Blot: DNA polymerase sigma Antibody (2F8) [H00011044-M01] - Analysis of POLS expression in transfected 293T cell line by POLS monoclonal antibody (M01), clone 2F8. Lane 1: POLS transfected lysate (59.9 KDa). ...read more
ELISA: DNA polymerase sigma Antibody (2F8) [H00011044-M01] - Detection limit for recombinant GST tagged POLS is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi, S-ELISA
Clone
2F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

DNA polymerase sigma Antibody (2F8) Summary

Immunogen
POLS (NP_008930, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETG
Specificity
POLS - polymerase (DNA directed) sigma
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TENT4A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNA polymerase sigma Antibody (2F8)

  • DNA polymerase kappa
  • DNA polymerase sigma
  • EC 2.7.7.7
  • LAK-1TUTase 5
  • PAP associated domain containing 7
  • POLKTRF41
  • POLSTUTASE5
  • polymerase (DNA directed) sigma
  • polymerase (DNA-directed) sigma
  • Terminal uridylyltransferase 5
  • Topoisomerase-related function protein 4-1
  • TRF4-1LAK1
  • TRF4PAP-associated domain-containing protein 7

Background

The protein encoded by this gene is a DNA polymerase that is likely involved in DNA repair. In addition, the encoded protein may be required for sister chromatid adhesion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PCNA Antibody
(PC10)
NB500-106
Western Blot: PCNA Antibody (PC10) [NB500-106] - Western blot of PCNA levels across different stages of the cell cycle. U-2 OS cells were synchronised at G1/S with 2 mM thymidine an released for 10 hours for G2/M or re-arrested in G2 for extended duration with 10uM RO-3306. Antibody at 1:2000. WB image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - Development of the germinal zones in the tree shrew neocortex. Immunofluorescence for PCNA (yellow) and DAPI staining (blue) on 30 um-cryosections of E32-P1 tree shrew neocortex. The top margin of the image corresponds to the transition zone SVZ/intermediate zone. Scale bars, 50 um. VZ, ventricular zone; SVZ, subventricular zone; iSVZ, inner SVZ; oSVZ, outer SVZ. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fnana.2018.00029/full), licensed under a CC-BY licence.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Analysis of PCNA in mouse cornea. Image courtesy of product review by Bo-Yie Chen.
(5 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
FUS Antibody
NB100-565
Knockout Validated: FUS Antibody [NB100-565] - Western blot shows lysates of HEK293 human embryonic kidney parental cell line and FUS knockout (KO) HEK293 human embryonic kidney cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human FUS Polyclonal Antibody (Catalog # NB100-565) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for FUS at approximately 75 kDa (as indicated) in the parental HEK293 celll line, but is not detectable in the knockout HEK293 cell line. This experiment was conducted under reducing conditions.
Western Blot: FUS Antibody [NB100-565] - Whole cell lysate (50 ug) from HepG2, HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Affinity purified rabbit anti-FUS antibody used for WB at 0.04 ug/mL. Detection: chemiluminescence with an exposure time of 10 seconds.
Immunocytochemistry/Immunofluorescence: FUS Antibody [NB100-565] - FUS (NB100-565) (green), b-III Tubulin (white), DAPI (blue). FUS antibody dilution: 1:300 in PBST (0.1% Triton X-100) + 10% GS O/N 4C. ICC/IF image submitted by a verified customer review.
(4 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
DNA Polymerase
beta Antibody
NBP2-38600
Western Blot: DNA Polymerase beta Antibody [NBP2-38600] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human liver shows low expression as expected.
(1 Review)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
REV1
Overexpression Lysate
NBL1-15290
Western Blot: REV1 Overexpression Lysate (Adult Normal) [NBL1-15290] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for REV1.
Species: Hu
XPV/DNA polymerase
eta Antibody
NB100-60424
Western Blot: XPV/DNA polymerase eta Antibody [NB100-60424] - Detection of human PolH by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, and Jurkat cells prepared using NETN lysis buffer. Antibody: Affinity purified Rabbit anti-PolH antibody NB100-60424 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: XPV/DNA polymerase eta Antibody [NB100-60424] - Detection of human XPV/DNA polymerase eta/PolH by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from Hela cells prepared using NETN lysis buffer. Antibodies: Affinity purified Rabbit anti-PolH antibody NB100-60424 (lot 3) used for IP at 6 ug per reaction. PolH was also immunoprecipitated by a previous lot of this antibody (lot 2) and rabbit anti-PolH antibody NB100-60423. For blotting immunoprecipitated PolH, NB100-60424 was used at 0.1 ug/ml. Chemiluminescence with an exposure time of 3 minutes.
(2 Publications)
Species: Hu
Applications: WB, IP
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(645 Publications)
Species: Hu
DR3/TNFRSF25
Antibody (59204) [Unc ...
MAB943
Mouse splenocytes either (A) untreated or (B) treated with PMA and Calcium Ionomycin for 24 hours were stained with Mouse Anti-Human DR3/TNFRSF25 Monoclonal Antibody (Catalog # MAB943) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B) and Rat Anti-Mouse CD3 PE‑conjugated Monoclonal Antibody (Catalog # FAB4841P). Quadrant markers were set based on control antibody staining (Catalog # MAB002).
Human peripheral blood mononuclear cells (PBMCs) either (A) untreated or (B) treated with PMA and Calcium Ionomycin for 24 hours were stained with Mouse Anti-Human DR3/TNFRSF25 Monoclonal Antibody (Catalog # MAB943) followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B) and Mouse Anti-Human CD3 epsilon APC‑conjugated Monoclonal Antibody (Catalog # FAB100A). Quadrant markers were set based on control antibody staining (Catalog # MAB002).
Western blot shows lysates of human CD8+ T cells. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human/Mouse DR3/TNFRSF25 Monoclonal Antibody (Catalog # MAB943) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for DR3/TNFRSF25 at approximately 55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Publications)
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
DNA Polymerase
iota Antibody
NB100-175
Western Blot: DNA Polymerase iota Antibody [NB100-175] - Western blot analysis of DNA Polymerase iota in NIH-3T3 whole cell lysate.
Immunocytochemistry/Immunofluorescence: DNA Polymerase iota Antibody [NB100-175] - The DNA Polymerase Iota Antibody was tested in HeLa cells at a 1:250 dilution against Dylight 488 (Green). Alpha-tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue).
(4 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF
DREF Antibody
(OTI5A2) - Azide and ...
NBP2-71419
Western Blot: DREF Antibody (OTI5A2) - Azide and BSA Free [NBP2-71419] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DREF.
Immunohistochemistry: DREF Antibody (OTI5A2) - Azide and BSA Free [NBP2-71419] - Analysis of Human pancreas tissue.
Flow Cytometry: DREF Antibody (OTI5A2) - Azide and BSA Free [NBP2-71419] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by DREF1 antibody.
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Recombinant Human
TRAM1 GST (N-Term) Pr ...
H00023471-P01
SDS-Page: Recombinant Human TRAM1 Protein [H00023471-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
DNA polymerase
theta Antibody (1C11)
H00010721-M09
Western Blot: DNA polymerase theta Antibody (1C11) [H00010721-M09]
ELISA: DNA polymerase theta Antibody (1C11) [H00010721-M09] - Detection limit for recombinant GST tagged POLQ is approximately 1ng/ml as a capture antibody.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ELISA, S-ELISA
Dermatopontin
Antibody
AF4629
Western blot shows lysates of human heart tissue. PVDF Membrane was probed with 1 µg/mL of Human Dermatopontin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4629) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Dermatopontin at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
DNA polymerase mu
Antibody
NBP2-57664
Western Blot: DNA polymerase mu Antibody [NBP2-57664] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/Immunofluorescence: DNA polymerase mu Antibody [NBP2-57664] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol.
Species: Hu
Applications: WB, ICC/IF
Recombinant Human
REV3L GST (N-Term) Pr ...
H00005980-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
DNASE1 Antibody
NBP1-84999
Western Blot: DNASE1 Antibody [NBP1-84999] - Analysis in control (vector only transfected HEK293T lysate) and DNASE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Analysis in human duodenum and liver tissues using Anti-DNASE1 antibody. Corresponding DNASE1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
TdT Antibody
NBP2-31368
Western Blot: TdT Antibody [NBP2-31368] - WB detection of TDT protein in (A) lysate of MOLT4 human leukemia cell line and (B) partial recombinant protein by using TDT antibody. Primary antibody concentration used: 1 ug/ml for Molt4 lysate, 0.05 ug/ml for recombinant protein.
Immunocytochemistry/Immunofluorescence: TdT Antibody [NBP2-31368] - TdT antibody was tested in A431 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). An antibody concentration of 0.01 ug/ml was used. Image objective 40x.
Immunohistochemistry-Paraffin: TdT Antibody [NBP2-31368] - IHC-P analysis of TdT protein in a section of human hepatocellular carcinoma (HCC) using TdT antibody at a concentration of 10 ug/ml. The HCC cells depicted strong nuclear / weak cytoplasmic positivity for TdT immunostaining.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DNA polymerase
sigma Antibody (2F8)
H00011044-M01
DNA polymerase sigma Antibody (2F8)
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA

Publications for DNA polymerase sigma Antibody (H00011044-M01) (0)

There are no publications for DNA polymerase sigma Antibody (H00011044-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA polymerase sigma Antibody (H00011044-M01) (0)

There are no reviews for DNA polymerase sigma Antibody (H00011044-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA polymerase sigma Antibody (H00011044-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional DNA polymerase sigma Products

Bioinformatics Tool for DNA polymerase sigma Antibody (H00011044-M01)

Discover related pathways, diseases and genes to DNA polymerase sigma Antibody (H00011044-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA polymerase sigma Antibody (H00011044-M01)

Discover more about diseases related to DNA polymerase sigma Antibody (H00011044-M01).
 

Pathways for DNA polymerase sigma Antibody (H00011044-M01)

View related products by pathway.

PTMs for DNA polymerase sigma Antibody (H00011044-M01)

Learn more about PTMs related to DNA polymerase sigma Antibody (H00011044-M01).

Blogs on DNA polymerase sigma

There are no specific blogs for DNA polymerase sigma, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA polymerase sigma Antibody (2F8) and receive a gift card or discount.


Bioinformatics

Gene Symbol TENT4A
Entrez
OMIM
Uniprot