DNA polymerase sigma Antibody (2F8)

Images

 
Western Blot: DNA polymerase sigma Antibody (2F8) [H00011044-M01] - Analysis of POLS over-expressed 293 cell line, cotransfected with POLS Validated Chimera RNAi ( Cat # H00011044-R01V ) (Lane 2) or non-transfected ...read more
Western Blot: DNA polymerase sigma Antibody (2F8) [H00011044-M01] - Analysis of POLS expression in transfected 293T cell line by POLS monoclonal antibody (M01), clone 2F8. Lane 1: POLS transfected lysate (59.9 KDa). ...read more
ELISA: DNA polymerase sigma Antibody (2F8) [H00011044-M01] - Detection limit for recombinant GST tagged POLS is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi, S-ELISA
Clone
2F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DNA polymerase sigma Antibody (2F8) Summary

Immunogen
POLS (NP_008930, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETG
Specificity
POLS - polymerase (DNA directed) sigma
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TENT4A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNA polymerase sigma Antibody (2F8)

  • DNA polymerase kappa
  • DNA polymerase sigma
  • EC 2.7.7.7
  • LAK-1TUTase 5
  • PAP associated domain containing 7
  • POLKTRF41
  • POLSTUTASE5
  • polymerase (DNA directed) sigma
  • polymerase (DNA-directed) sigma
  • Terminal uridylyltransferase 5
  • Topoisomerase-related function protein 4-1
  • TRF4-1LAK1
  • TRF4PAP-associated domain-containing protein 7

Background

The protein encoded by this gene is a DNA polymerase that is likely involved in DNA repair. In addition, the encoded protein may be required for sister chromatid adhesion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NBP2-38600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15290
Species: Hu
NB100-60424
Species: Hu
Applications: WB, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NB100-175
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-71419
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
H00010721-M09
Species: Hu
Applications: WB, ELISA, S-ELISA
AF4629
Species: Hu
Applications: WB
NBP2-57664
Species: Hu
Applications: WB, ICC/IF
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00011044-M01
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA

Publications for DNA polymerase sigma Antibody (H00011044-M01) (0)

There are no publications for DNA polymerase sigma Antibody (H00011044-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA polymerase sigma Antibody (H00011044-M01) (0)

There are no reviews for DNA polymerase sigma Antibody (H00011044-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA polymerase sigma Antibody (H00011044-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DNA polymerase sigma Products

Bioinformatics Tool for DNA polymerase sigma Antibody (H00011044-M01)

Discover related pathways, diseases and genes to DNA polymerase sigma Antibody (H00011044-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA polymerase sigma Antibody (H00011044-M01)

Discover more about diseases related to DNA polymerase sigma Antibody (H00011044-M01).
 

Pathways for DNA polymerase sigma Antibody (H00011044-M01)

View related products by pathway.

PTMs for DNA polymerase sigma Antibody (H00011044-M01)

Learn more about PTMs related to DNA polymerase sigma Antibody (H00011044-M01).

Blogs on DNA polymerase sigma

There are no specific blogs for DNA polymerase sigma, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA polymerase sigma Antibody (2F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol TENT4A
Entrez
OMIM
Uniprot