Home » DNA polymerase sigma » DNA polymerase sigma Antibodies » DNA polymerase sigma Antibody (2F8)

DNA polymerase sigma Antibody (2F8)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: DNA polymerase sigma Antibody (2F8) [H00011044-M01] - Analysis of POLS over-expressed 293 cell line, cotransfected with POLS Validated Chimera RNAi ( Cat # H00011044-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with POLS monoclonal antibody (M01), clone 2F8 (Cat # H00011044-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: DNA polymerase sigma Antibody (2F8) [H00011044-M01] - Analysis of POLS over-expressed 293 cell line, cotransfected with POLS Validated Chimera RNAi ( Cat # H00011044-R01V ) (Lane 2) or non-transfected ...read more
Western Blot: DNA polymerase sigma Antibody (2F8) [H00011044-M01] - Analysis of POLS expression in transfected 293T cell line by POLS monoclonal antibody (M01), clone 2F8. Lane 1: POLS transfected lysate (59.9 KDa). ...read more
ELISA: DNA polymerase sigma Antibody (2F8) [H00011044-M01] - Detection limit for recombinant GST tagged POLS is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, KD
Clone
2F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

DNA polymerase sigma Antibody (2F8) Summary

Immunogen
POLS (NP_008930, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETG
Specificity
POLS - polymerase (DNA directed) sigma
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TENT4A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNA polymerase sigma Antibody (2F8)

  • DNA polymerase kappa
  • DNA polymerase sigma
  • EC 2.7.7.7
  • LAK-1TUTase 5
  • PAP associated domain containing 7
  • POLKTRF41
  • POLSTUTASE5
  • polymerase (DNA directed) sigma
  • polymerase (DNA-directed) sigma
  • Terminal uridylyltransferase 5
  • Topoisomerase-related function protein 4-1
  • TRF4-1LAK1
  • TRF4PAP-associated domain-containing protein 7

Background

The protein encoded by this gene is a DNA polymerase that is likely involved in DNA repair. In addition, the encoded protein may be required for sister chromatid adhesion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Flow Cytometry: PCNA Antibody (PC10) [NB500-106] - An intracellular stain was performed on HepG2 cells with PCNA Antibody (PC10) NB500-106G (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 488.
(5 Reviews)
(38 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
FUS Antibody
NB100-565
Immunohistochemistry-Paraffin: FUS Antibody [NB100-565] - FFPE section of human ovarian carcinoma. Affinity purified rabbit anti-FUS used at a dilution of 1:1,000 (1 ug/mL). Detection: DAB
Immunohistochemistry-Paraffin: FUS Antibody [NB100-565] - FFPE section of mouse renal cells carcinoma. Affinity purified rabbit anti-FUS used at a dilution of 1:1,000 (1 ug/mL). Detection: DA
Western Blot: FUS Antibody [NB100-565] - Whole cell lysate (50 ug) from HepG2, HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Affinity purified rabbit anti-FUS antibody used for WB at 0.04 ug/mL. Detection: chemiluminescence with an exposure time of 10 seconds.
(4 Reviews)
(23 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
DNA Polymerase
beta Antibody
NBP2-38600
Immunocytochemistry/Immunofluorescence: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600] - Staining in human testis and liver tissues using anti-POLB antibody. Corresponding POLB RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human liver shows low expression as expected.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
REV1 Antibody
NBP3-09940
Western Blot: REV1 Antibody [NBP3-09940] - Western blot analysis of REV1 in Fetal Lung lysates. Antibody dilution at 1.0ug/ml
Species: Hu
Applications: WB
XPV/DNA polymerase
eta Antibody
AF3417
Western blot shows lysates of MRC-5 human embryonic lung fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Human XPV Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3417) followed by HRP‑conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for XPV at approximately 80 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 5.
Species: Hu
Applications: WB
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(708 Publications)
Species: Hu
Applications: BA
DR3/TNFRSF25
Antibody (59204) [Unc ...
MAB943
Mouse splenocytes either (A) untreated or (B) treated with PMA and Calcium Ionomycin for 24 hours were stained with Mouse Anti-Human DR3/TNFRSF25 Monoclonal Antibody (Catalog # MAB943) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B) and Rat Anti-Mouse CD3 PE‑conjugated Monoclonal Antibody (Catalog # FAB4841P). Quadrant markers were set based on control antibody staining (Catalog # MAB002).
Human peripheral blood mononuclear cells (PBMCs) either (A) untreated or (B) treated with PMA and Calcium Ionomycin for 24 hours were stained with Mouse Anti-Human DR3/TNFRSF25 Monoclonal Antibody (Catalog # MAB943) followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B) and Mouse Anti-Human CD3 epsilon APC‑conjugated Monoclonal Antibody (Catalog # FAB100A). Quadrant markers were set based on control antibody staining (Catalog # MAB002).
Western blot shows lysates of human CD8+ T cells. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human/Mouse DR3/TNFRSF25 Monoclonal Antibody (Catalog # MAB943) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for DR3/TNFRSF25 at approximately 55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
DNA Polymerase
iota Antibody
NB100-175
Western Blot: DNA Polymerase iota Antibody [NB100-175] - Western blot analysis of DNA Polymerase iota in NIH-3T3 whole cell lysate.
Immunocytochemistry/Immunofluorescence: DNA Polymerase iota Antibody [NB100-175] - The DNA Polymerase Iota Antibody was tested in HeLa cells at a 1:250 dilution against Dylight 488 (Green). Alpha-tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue).
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, WB
DREF Antibody
(OTI5A2) - Azide and ...
NBP2-71419
Western Blot: DREF Antibody (OTI5A2) - Azide and BSA Free [NBP2-71419] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DREF.
Flow Cytometry: DREF Antibody (OTI5A2) - Azide and BSA Free [NBP2-71419] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by DREF1 antibody.
Immunohistochemistry: DREF Antibody (OTI5A2) - Azide and BSA Free [NBP2-71419] - Analysis of Adenocarcinoma of Human colon tissue.
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Recombinant Human
TRAM1 GST (N-Term) Pr ...
H00023471-P01
SDS-Page: Recombinant Human TRAM1 Protein [H00023471-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
DNA polymerase
theta Antibody (1C11)
H00010721-M09
Western Blot: DNA polymerase theta Antibody (1C11) [H00010721-M09]
ELISA: DNA polymerase theta Antibody (1C11) [H00010721-M09] - Detection limit for recombinant GST tagged POLQ is approximately 1ng/ml as a capture antibody.
(1 Review)
(2 Publications)
Species: Hu
Applications: ELISA, WB
Dermatopontin
Antibody
AF4629
Western blot shows lysates of human heart tissue. PVDF Membrane was probed with 1 µg/mL of Human Dermatopontin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4629) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Dermatopontin at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
DNA polymerase mu
Antibody
NBP2-57664
Western Blot: DNA polymerase mu Antibody [NBP2-57664] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/Immunofluorescence: DNA polymerase mu Antibody [NBP2-57664] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol.
Species: Hu
Applications: ICC/IF, WB
Recombinant Human
REV3L GST (N-Term) Pr ...
H00005980-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
DNASE1 Antibody
NBP1-84999
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Analysis in human duodenum and liver tissues using Anti-DNASE1 antibody. Corresponding DNASE1 RNA-seq data are presented for the same tissues.
Western Blot: DNASE1 Antibody [NBP1-84999] - Analysis in control (vector only transfected HEK293T lysate) and DNASE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Staining of human liver shows low expression as expected.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
TdT Antibody
NBP2-31368
Western Blot: TdT Antibody [NBP2-31368] - WB detection of TDT protein in (A) lysate of MOLT4 human leukemia cell line and (B) partial recombinant protein by using TDT antibody. Primary antibody concentration used: 1 ug/ml for Molt4 lysate, 0.05 ug/ml for recombinant protein.
Immunohistochemistry-Paraffin: TdT Antibody [NBP2-31368] - IHC-P analysis of TdT protein in a section of human lung using TdT antibody at a concentration of 10 ug/ml. The alveolar cells of the lungs showed strong nuclear / weak cytoplasmic positivity for TdT immunostaining.
Immunohistochemistry-Paraffin: TdT Antibody [NBP2-31368] - IHC-P analysis of TdT protein in a section of human hepatocellular carcinoma (HCC) using TdT antibody at a concentration of 10 ug/ml. The HCC cells depicted strong nuclear / weak cytoplasmic positivity for TdT immunostaining.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DNA polymerase
sigma Antibody (2F8)
H00011044-M01
DNA polymerase sigma Antibody (2F8)
Species: Hu
Applications: WB, ELISA, KD

Publications for DNA polymerase sigma Antibody (H00011044-M01) (0)

There are no publications for DNA polymerase sigma Antibody (H00011044-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA polymerase sigma Antibody (H00011044-M01) (0)

There are no reviews for DNA polymerase sigma Antibody (H00011044-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA polymerase sigma Antibody (H00011044-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNA polymerase sigma Products

Bioinformatics Tool for DNA polymerase sigma Antibody (H00011044-M01)

Discover related pathways, diseases and genes to DNA polymerase sigma Antibody (H00011044-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA polymerase sigma Antibody (H00011044-M01)

Discover more about diseases related to DNA polymerase sigma Antibody (H00011044-M01).
 

Pathways for DNA polymerase sigma Antibody (H00011044-M01)

View related products by pathway.

PTMs for DNA polymerase sigma Antibody (H00011044-M01)

Learn more about PTMs related to DNA polymerase sigma Antibody (H00011044-M01).

Blogs on DNA polymerase sigma

There are no specific blogs for DNA polymerase sigma, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA polymerase sigma Antibody (2F8) and receive a gift card or discount.


Bioinformatics

Gene Symbol TENT4A
Entrez
OMIM
Uniprot