We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DNA Polymerase gamma Recombinant Protein Antigen

Images

 
There are currently no images for DNA Polymerase gamma Recombinant Protein Antigen (NBP3-17832PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DNA Polymerase gamma Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNA Polymerase gamma

Source: E. coli

Amino Acid Sequence: PKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEAGLAEEFLLTD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POLG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17832.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNA Polymerase gamma Recombinant Protein Antigen

  • DNA Polymerase gamma
  • DNA polymerase subunit gamma-1
  • EC 2.7.7.7
  • FLJ27114
  • MDP1
  • MIRAS
  • Mitochondrial DNA polymerase catalytic subunit
  • MTDPS4A
  • POLG
  • PolG, catalytic subunit
  • POLG1
  • POLG1MTDPS4B
  • POLGA
  • PolG-alpha
  • POLGAPEO
  • polymerase (DNA directed), gamma
  • SANDO
  • SCAE

Background

As the only DNA polymerase (pol) present in mitochondria, DNA polymerase gamma (POLG) is necessarily implicated in base excision repair processes to correct oxidative damage to the mitochondrial genome. Therefore, the ability of the catalytic subunit of human POLG has been tested to participate in uracil-provoked base excision repair reconstituted in vitro with purified components. Subsequent to actions of uracil-DNA glycosylase and apurinic/apyrimidinic endonuclease, human POLG is able to fill a single nucleotide gap in the presence of a 5' terminal deoxyribose phosphate (dRP) flap. The catalytic subunit of human pol gamma catalyzes release of the dRP residue from incised apurinic/apyrimidinic sites to produce a substrate for DNA ligase. Faulty replication of the human mitochondrial genome is thought to be the cause of many diseases. The low selectivity of the mitochondrial DNA polymerase is implicated as the cause of many side effects observed in the treatment of viral infections such as HIV.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37986
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP3-35061
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC,  IHC-P, WB
H00009033-M01
Species: Hu, Mu, Rt
Applications: ELISA, PAGE, WB
AF743
Species: Mu
Applications: CyTOF-ready, Flow, WB
NBP1-92298
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00005498-M01
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, KD, WB
AF8065
Species: Hu
Applications: WB
NBP2-49251
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-94064
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF3788
Species: Hu
Applications: WB
MAB7265
Species: Mu
Applications: IHC, WB
NBP1-79890
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for DNA Polymerase gamma Recombinant Protein Antigen (NBP3-17832PEP) (0)

There are no publications for DNA Polymerase gamma Recombinant Protein Antigen (NBP3-17832PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Polymerase gamma Recombinant Protein Antigen (NBP3-17832PEP) (0)

There are no reviews for DNA Polymerase gamma Recombinant Protein Antigen (NBP3-17832PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNA Polymerase gamma Recombinant Protein Antigen (NBP3-17832PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNA Polymerase gamma Products

Research Areas for DNA Polymerase gamma Recombinant Protein Antigen (NBP3-17832PEP)

Find related products by research area.

Blogs on DNA Polymerase gamma

There are no specific blogs for DNA Polymerase gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNA Polymerase gamma Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POLG