Recombinant Human DNA Polymerase gamma Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DNA Polymerase gamma Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1130 - 1239 of Human POLG partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
POLG

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM Tris-HCl, pH 8.0, 1 mM dithiothreitol, 20% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DNA Polymerase gamma Protein

  • DNA polymerase subunit gamma-1
  • EC 2.7.7.7
  • FLJ27114
  • MDP1
  • MIRAS
  • Mitochondrial DNA polymerase catalytic subunit
  • MTDPS4A
  • PolG, catalytic subunit
  • POLG1MTDPS4B
  • PolG-alpha
  • POLGAPEO
  • polymerase (DNA directed), gamma
  • SANDO
  • SCAE

Background

POLG - polymerase (DNA directed), gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NBP2-37986
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005498-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84256
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76781
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB7265
Species: Mu
Applications: WB, IHC
NBP1-92505
Species: Hu
Applications: WB, IHC, IHC-P
H00005428-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for DNA Polymerase gamma Partial Recombinant Protein (H00005428-Q01) (0)

There are no publications for DNA Polymerase gamma Partial Recombinant Protein (H00005428-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Polymerase gamma Partial Recombinant Protein (H00005428-Q01) (0)

There are no reviews for DNA Polymerase gamma Partial Recombinant Protein (H00005428-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA Polymerase gamma Partial Recombinant Protein (H00005428-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNA Polymerase gamma Products

Bioinformatics Tool for DNA Polymerase gamma Partial Recombinant Protein (H00005428-Q01)

Discover related pathways, diseases and genes to DNA Polymerase gamma Partial Recombinant Protein (H00005428-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA Polymerase gamma Partial Recombinant Protein (H00005428-Q01)

Discover more about diseases related to DNA Polymerase gamma Partial Recombinant Protein (H00005428-Q01).
 

Pathways for DNA Polymerase gamma Partial Recombinant Protein (H00005428-Q01)

View related products by pathway.

PTMs for DNA Polymerase gamma Partial Recombinant Protein (H00005428-Q01)

Learn more about PTMs related to DNA Polymerase gamma Partial Recombinant Protein (H00005428-Q01).
 

Research Areas for DNA Polymerase gamma Partial Recombinant Protein (H00005428-Q01)

Find related products by research area.

Blogs on DNA Polymerase gamma

There are no specific blogs for DNA Polymerase gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DNA Polymerase gamma Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POLG