DNA Polymerase epsilon subunit 3 Antibody - BSA Free

Western Blot: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785] - Staining of human cell line PC-3 shows localization to nucleus & nucleoli.

Immunohistochemistry-Paraffin: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785] - Staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DNA Polymerase epsilon subunit 3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLN
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POLE3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DNA Polymerase epsilon subunit 3 Protein (NBP2-13785PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DNA Polymerase epsilon subunit 3 Antibody - BSA Free

• Arsenic-transactivated protein
• asTP
• CHARAC17arsenic transactivated protein
• CHRAC-17
• CHRAC17Ybl1
• Chromatin accessibility complex 17 kDa protein
• DNA polymerase epsilon p17 subunit
• DNA polymerase epsilon subunit 3
• DNA polymerase epsilon subunit p17
• DNA polymerase II subunit 3
• EC 2.7.7.7
• histone fold protein CHRAC17
• huCHRAC17
• p17
• polymerase (DNA directed), epsilon 3 (p17 subunit)
• YBL1

Background

DNA polymerase epsilon (POLE) is an enzyme that helps catalyze in the polymerization of deoxyribonucleotides into a DNA strand. The C-terminus of DNA polymerase E subunit complexes with subunits B and C, whereas the N-terminal domain contains an active polymerase domain.

DNA Pol E antibodies are useful for DNA replication and repair studies and in research on mitosis and cell replication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POLE3