DNA Polymerase epsilon subunit 3 Antibody


Western Blot: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785] - Staining of human cell line PC-3 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785] - Staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

DNA Polymerase epsilon subunit 3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATS CANNFAMKGKRKTLN
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNA Polymerase epsilon subunit 3 Protein (NBP2-13785PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DNA Polymerase epsilon subunit 3 Antibody

  • Arsenic-transactivated protein
  • asTP
  • CHARAC17arsenic transactivated protein
  • CHRAC-17
  • CHRAC17Ybl1
  • Chromatin accessibility complex 17 kDa protein
  • DNA polymerase epsilon p17 subunit
  • DNA polymerase epsilon subunit 3
  • DNA polymerase epsilon subunit p17
  • DNA polymerase II subunit 3
  • EC
  • histone fold protein CHRAC17
  • huCHRAC17
  • p17
  • polymerase (DNA directed), epsilon 3 (p17 subunit)
  • YBL1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DNA Polymerase epsilon subunit 3 Antibody (NBP2-13785) (0)

There are no publications for DNA Polymerase epsilon subunit 3 Antibody (NBP2-13785).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Polymerase epsilon subunit 3 Antibody (NBP2-13785) (0)

There are no reviews for DNA Polymerase epsilon subunit 3 Antibody (NBP2-13785). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNA Polymerase epsilon subunit 3 Antibody (NBP2-13785) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DNA Polymerase epsilon subunit 3 Products

Bioinformatics Tool for DNA Polymerase epsilon subunit 3 Antibody (NBP2-13785)

Discover related pathways, diseases and genes to DNA Polymerase epsilon subunit 3 Antibody (NBP2-13785). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for DNA Polymerase epsilon subunit 3 Antibody (NBP2-13785)

View related products by pathway.

PTMs for DNA Polymerase epsilon subunit 3 Antibody (NBP2-13785)

Learn more about PTMs related to DNA Polymerase epsilon subunit 3 Antibody (NBP2-13785).

Research Areas for DNA Polymerase epsilon subunit 3 Antibody (NBP2-13785)

Find related products by research area.

Blogs on DNA Polymerase epsilon subunit 3

There are no specific blogs for DNA Polymerase epsilon subunit 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DNA Polymerase epsilon subunit 3 Antibody and receive a gift card or discount.


Gene Symbol POLE3