DNA Polymerase delta, catalytic subunit Recombinant Protein Antigen

Images

 
There are currently no images for DNA Polymerase delta, catalytic subunit Protein (NBP2-33466PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DNA Polymerase delta, catalytic subunit Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLD1.

Source: E. coli

Amino Acid Sequence: YALRLKEKATQCQLEADVLWSDVVSHPPEGPWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCAPILGAKVQSYEKEEDLLQAWSTFIRIMDPD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POLD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33466.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNA Polymerase delta, catalytic subunit Recombinant Protein Antigen

  • CDC2 homolog
  • CDC2
  • DNA polymerase delta catalytic subunit
  • DNA polymerase subunit delta p125
  • DNA-directed polymerase delta 1
  • EC 2.7.7.7
  • POLD
  • polymerase (DNA directed), delta 1, catalytic subunit (125kD)
  • polymerase (DNA directed), delta 1, catalytic subunit 125kDa

Background

DNA polymerase d (delta) functions in DNA replication and DNA repair. It also possesses 3' to 5' exonuclease activity. In leading strand synthesis it requires the processivity factor, PCNA. It is also possibly involved in the completion of DNA synthesis during Okazaki fragment elongation following the initiation of synthesis by the DNA polymerase a/primase complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF4654
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
MAB4459
Species: Hu, Mu, Rt
Applications: WB
H00000902-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-87539
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-87905
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-33506
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
MAB32652
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, KO
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-47754
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC,  IHC-P, WB

Publications for DNA Polymerase delta, catalytic subunit Protein (NBP2-33466PEP) (0)

There are no publications for DNA Polymerase delta, catalytic subunit Protein (NBP2-33466PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Polymerase delta, catalytic subunit Protein (NBP2-33466PEP) (0)

There are no reviews for DNA Polymerase delta, catalytic subunit Protein (NBP2-33466PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNA Polymerase delta, catalytic subunit Protein (NBP2-33466PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNA Polymerase delta, catalytic subunit Products

Research Areas for DNA Polymerase delta, catalytic subunit Protein (NBP2-33466PEP)

Find related products by research area.

Blogs on DNA Polymerase delta, catalytic subunit

There are no specific blogs for DNA Polymerase delta, catalytic subunit, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNA Polymerase delta, catalytic subunit Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POLD1