DNA helicase B Antibody

Images

 
Western Blot: DNA helicase B Antibody [NBP1-57267] - Jurkat cell lysate, concentration 2.5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNA helicase B Antibody Summary

Immunogen
Synthetic peptides corresponding to DNA helicase B The peptide sequence was selected from the N terminal of DNA helicase B. Peptide sequence FGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHI. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HELB
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HELB and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DNA helicase B Antibody

  • DNA helicase B
  • hDHB
  • helicase (DNA) B

Background

The protein encoded by this gene is a DNA helicase. A dominant-negative mutant of this protein blocks chromosomal DNA replication and suggests that its function is required for S phase entry.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2204
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-32016
Species: Hu
Applications: IHC, IHC-P
NBP1-90113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-82485
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-302
Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Flow-IC
MAB4479
Species: Hu
Applications: IHC
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-47310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00776
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33105
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-82642
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00004176-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NBP1-86928
Species: Hu
Applications: WB, IHC, IHC-P
NB300-147
Species: Hu, Rt, Po, Bv, Ca, Ch, Ha, Rb, Xp, Mu(-)
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00004143-M01
Species: Hu, Ce
Applications: WB, ELISA, IP
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for DNA helicase B Antibody (NBP1-57267) (0)

There are no publications for DNA helicase B Antibody (NBP1-57267).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA helicase B Antibody (NBP1-57267) (0)

There are no reviews for DNA helicase B Antibody (NBP1-57267). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA helicase B Antibody (NBP1-57267) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DNA helicase B Products

Bioinformatics Tool for DNA helicase B Antibody (NBP1-57267)

Discover related pathways, diseases and genes to DNA helicase B Antibody (NBP1-57267). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA helicase B Antibody (NBP1-57267)

Discover more about diseases related to DNA helicase B Antibody (NBP1-57267).
 

Pathways for DNA helicase B Antibody (NBP1-57267)

View related products by pathway.

Blogs on DNA helicase B

There are no specific blogs for DNA helicase B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA helicase B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HELB
Uniprot