DMTF1 Antibody (5C6)

Images

 
Western Blot: DMTF1 Antibody (5C6) [H00009988-M03] - Analysis of DMTF1 expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: DMTF1 Antibody (5C6) [H00009988-M03] - Analysis of monoclonal antibody to DMTF1 on HeLa cell. Antibody concentration 30 ug/ml
Immunohistochemistry-Paraffin: DMTF1 Antibody (5C6) [H00009988-M03] - Analysis of monoclonal antibody to DMTF1 on formalin-fixed paraffin-embedded human colon. Antibody concentration 1 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
5C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DMTF1 Antibody (5C6) Summary

Immunogen
DMTF1 (NP_066968, 661 a.a. ~ 760 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KQEESPSDLASAYVTEGLESPTIEEQVDQTIDDETILIVPSPHGFIQASDVIDTESVLPLTTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH
Specificity
DMTF1 - cyclin D binding myb-like transcription factor 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DMTF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DMTF1 Antibody (5C6)

  • cyclin D binding myb-like transcription factor 1
  • cyclin D-binding Myb-like protein 1
  • cyclin-D-binding Myb-like transcription factor 1
  • Cyclin-D-interacting Myb-like protein 1
  • DMP1FLJ76054
  • FLJ25188
  • FLJ41265
  • hDMP1DMTF
  • hDMTF1

Background

This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92546
Species: Hu, Mu, Rt
Applications: WB
4014-SP
Species: Hu
Applications: BA
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
2629-FG/CF
Species: Mu
Applications: BA
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
8090-ZN
Species: Hu
Applications: EnzAct
AF6150
Species: Mu
Applications: WB
MAB7665
Species: Hu
Applications: IHC, WB
MAB9080
Species: Hu
Applications: WB
NBP1-77461
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91816
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DPI00
Species: Hu
Applications: ELISA
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu, Mu
Applications: IHC, IP, WB
H00009988-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC

Publications for DMTF1 Antibody (H00009988-M03) (0)

There are no publications for DMTF1 Antibody (H00009988-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DMTF1 Antibody (H00009988-M03) (0)

There are no reviews for DMTF1 Antibody (H00009988-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DMTF1 Antibody (H00009988-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DMTF1 Products

Array H00009988-M03

Diseases for DMTF1 Antibody (H00009988-M03)

Discover more about diseases related to DMTF1 Antibody (H00009988-M03).
 

Pathways for DMTF1 Antibody (H00009988-M03)

View related products by pathway.

PTMs for DMTF1 Antibody (H00009988-M03)

Learn more about PTMs related to DMTF1 Antibody (H00009988-M03).
 

Research Areas for DMTF1 Antibody (H00009988-M03)

Find related products by research area.

Blogs on DMTF1

There are no specific blogs for DMTF1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DMTF1 Antibody (5C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol DMTF1
Entrez
OMIM
Uniprot