DMRTA1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit DMRTA1 Antibody - BSA Free (NBP2-84795) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse DMRTA1. Peptide sequence: LRRQQAQEESEARGLHRLLYQGSSGSGAQASGGSGRTESPQVLNNPMAVA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DMRTA1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for DMRTA1 Antibody - BSA Free
Background
DMRTA1, also known as Doublesex and mab-3-related transcription factor A1, is a 53.1 kDa, 504 amino acid protein that is expressed in the prostate, pancreas, liver, and kidney as a member of the DMRT family. Current research is exploring the involvement of the protein with prostatitis and metabolic acidosis. The protein interacts with STAT5B and ORC5 proteins in transcription pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Publications for DMRTA1 Antibody (NBP2-84795) (0)
There are no publications for DMRTA1 Antibody (NBP2-84795).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DMRTA1 Antibody (NBP2-84795) (0)
There are no reviews for DMRTA1 Antibody (NBP2-84795).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DMRTA1 Antibody (NBP2-84795) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DMRTA1 Products
Blogs on DMRTA1