DMPK Antibody (2F7)

Images

 
Western Blot: DMPK Antibody (2F7) [H00001760-M01] - Analysis of DMPK expression in transfected 293T cell line by DMPK monoclonal antibody (M01), clone 2F7.Lane 1: DMPK transfected lysate(69.4 KDa).Lane 2: ...read more
Western Blot: DMPK Antibody (2F7) [H00001760-M01] - Analysis of DMPK over-expressed 293 cell line, cotransfected with DMPK Validated Chimera RNAi ( Cat # H00001760-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
ELISA: DMPK Antibody (2F7) [H00001760-M01] - Detection limit for recombinant GST tagged DMPK is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
2F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DMPK Antibody (2F7) Summary

Immunogen
DMPK (AAH62553 303 a.a. - 420 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFDLVEDGLTAMVSGGGETLSDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTP
Specificity
DMPK - dystrophia myotonica-protein kinase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DMPK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DMPK Antibody (2F7)

  • DM1
  • DM1PK
  • DMK
  • DMKEC 2.7.11.1
  • DM-kinase
  • DMmyotonin protein kinase A
  • DMPK
  • dystrophia myotonica-protein kinase
  • MDPK
  • MDPKDM protein kinase
  • MT-PK
  • MT-PKmyotonic dystrophy associated protein kinase
  • Myotonic dystrophy protein kinase
  • myotonin-protein kinase
  • thymopoietin homolog

Background

The protein encoded by this gene is a serine-threonine kinase that is closely related to other kinases that interact with members of the Rho family of small GTPases. Substrates for this enzyme include myogenin, the beta-subunit of the L-type calcium channels, and phospholemman. The 3' untranslated region of this gene contains 5-37 copies of a CTG trinucleotide repeat. Expansion of this unstable motif to 50-5,000 copies causes myotonic dystrophy type I, which increases in severity with increasing repeat element copy number. Repeat expansion is associated with condensation of local chromatin structure that disrupts the expression of genes in this region. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-12553
Species: Hu
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-04611
Species: Hu
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB38461
Species: Hu
Applications: WB, IHC
H00347527-B01P
Species: Hu
Applications: WB, ELISA
NB200-316
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DMPK Antibody (H00001760-M01) (0)

There are no publications for DMPK Antibody (H00001760-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DMPK Antibody (H00001760-M01) (0)

There are no reviews for DMPK Antibody (H00001760-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DMPK Antibody (H00001760-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DMPK Products

Bioinformatics Tool for DMPK Antibody (H00001760-M01)

Discover related pathways, diseases and genes to DMPK Antibody (H00001760-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DMPK Antibody (H00001760-M01)

Discover more about diseases related to DMPK Antibody (H00001760-M01).
 

Pathways for DMPK Antibody (H00001760-M01)

View related products by pathway.

PTMs for DMPK Antibody (H00001760-M01)

Learn more about PTMs related to DMPK Antibody (H00001760-M01).
 

Research Areas for DMPK Antibody (H00001760-M01)

Find related products by research area.

Blogs on DMPK

There are no specific blogs for DMPK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DMPK Antibody (2F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol DMPK
Entrez
OMIM
Uniprot