DMGDH Antibody - BSA Free

Western Blot: DMGDH Antibody [NBP2-87279] - Host: Rabbit. Target Name: Dmgdh. Sample Type: Mouse Liver lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DMGDH Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse DMGDH. Peptide sequence: SELHDLRWIEEAAFRGGYDVEIQNITDEFGVLGVAGPYARRVLQKLTSE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DMGDH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DMGDH Antibody - BSA Free

• dimethylglycine dehydrogenase
• dimethylglycine dehydrogenase, mitochondrial
• DMGDHD
• EC 1.5.99.2
• ME2GLYDH

Background

The DMGDH gene encodes an enzyme involved in the catabolism of choline, catalyzing the oxidative demethylation of dimethylglycine to form sarcosine. The enzyme is found as a monomer in the mitochondrial matrix, and uses flavin adenine dinucleotide and folate a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DMGDH