DMAP1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit DMAP1 Antibody - BSA Free (NBP2-87276) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human DMAP1. Peptide sequence: MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DMAP1 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
1 mg/ml |
| Purity |
Protein A purified |
Alternate Names for DMAP1 Antibody - BSA Free
Background
DMAP1 (DNA methyltransferase 1 associated protein 1) has been identified as a subunit of several distinct protein complexes involved in the repression and activation of transcription. It has been observed to interact with histone deacetylase 2 (HDAC2) as well as histone acetyltransferase (HAT) indicating a role in nucleosome modification to regulate transcription. DMAP1 can act independently to repress transcription in association with DNA methyltransferase 1. Alternate names for DMAP1 include DNMT1-associated protein 1, DNMAP1, DMAP1, KIAA1425, EAF2, SWC4, DNMAP1, DNMTAP1, FLJ11543, and DKFZp686L09142.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, CyTOF-ready, Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, KD, KO, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu
Applications: ELISA
Publications for DMAP1 Antibody (NBP2-87276) (0)
There are no publications for DMAP1 Antibody (NBP2-87276).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DMAP1 Antibody (NBP2-87276) (0)
There are no reviews for DMAP1 Antibody (NBP2-87276).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DMAP1 Antibody (NBP2-87276) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DMAP1 Products
Research Areas for DMAP1 Antibody (NBP2-87276)
Find related products by research area.
|
Blogs on DMAP1