DLX5 Antibody (4H6)

Images

 
Immunocytochemistry/ Immunofluorescence: DLX5 Antibody (4H6) [H00001749-M07] - Analysis of monoclonal antibody to DLX5 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: DLX5 Antibody (4H6) [H00001749-M07] - Detection limit for recombinant GST tagged DLX5 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
4H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DLX5 Antibody (4H6) Summary

Immunogen
DLX5 (NP_005212, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNR*
Specificity
DLX5 (4H6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DLX5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DLX5 Antibody (4H6)

  • distal-less homeo box 5
  • distal-less homeobox 5
  • DLX5
  • homeobox protein DLX-5

Background

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

355-BM/CF
Species: Hu, Mu, Rt
NBP1-85929
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38019
Species: Hu
Applications: IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
H00001746-M06
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
H00001745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
H00001749-M07
Species: Hu
Applications: ELISA, ICC/IF

Publications for DLX5 Antibody (H00001749-M07) (0)

There are no publications for DLX5 Antibody (H00001749-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DLX5 Antibody (H00001749-M07) (0)

There are no reviews for DLX5 Antibody (H00001749-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DLX5 Antibody (H00001749-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DLX5 Products

Bioinformatics Tool for DLX5 Antibody (H00001749-M07)

Discover related pathways, diseases and genes to DLX5 Antibody (H00001749-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLX5 Antibody (H00001749-M07)

Discover more about diseases related to DLX5 Antibody (H00001749-M07).
 

Pathways for DLX5 Antibody (H00001749-M07)

View related products by pathway.

PTMs for DLX5 Antibody (H00001749-M07)

Learn more about PTMs related to DLX5 Antibody (H00001749-M07).
 

Research Areas for DLX5 Antibody (H00001749-M07)

Find related products by research area.

Blogs on DLX5

There are no specific blogs for DLX5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DLX5 Antibody (4H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol DLX5
Entrez
OMIM
Uniprot