DLK2/EGFL9 Antibody


Immunohistochemistry-Paraffin: DLK2/EGFL9 Antibody [NBP2-31847] - DLK2 Antibody [NBP2-31847] - Staining of human cerebellum shows strong nucleolar positivity in Purkinje cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P

Order Details

DLK2/EGFL9 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: RNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSC
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DLK2/EGFL9 Protein (NBP2-31847PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DLK2/EGFL9 Antibody

  • delta-like 2 homolog (Drosophila)
  • DLK2
  • DLK-2
  • EGFL9
  • EGF-like protein 9
  • EGF-like-domain, multiple 9
  • Epidermal growth factor-like protein 9
  • MGC111055
  • MGC2487
  • protein delta homolog 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, Simple Western, Flow, IHC
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Mu
Applications: WB, ChIP, ICC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA

Publications for DLK2/EGFL9 Antibody (NBP2-31847) (0)

There are no publications for DLK2/EGFL9 Antibody (NBP2-31847).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DLK2/EGFL9 Antibody (NBP2-31847) (0)

There are no reviews for DLK2/EGFL9 Antibody (NBP2-31847). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DLK2/EGFL9 Antibody (NBP2-31847) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DLK2/EGFL9 Products

Bioinformatics Tool for DLK2/EGFL9 Antibody (NBP2-31847)

Discover related pathways, diseases and genes to DLK2/EGFL9 Antibody (NBP2-31847). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLK2/EGFL9 Antibody (NBP2-31847)

Discover more about diseases related to DLK2/EGFL9 Antibody (NBP2-31847).

Pathways for DLK2/EGFL9 Antibody (NBP2-31847)

View related products by pathway.

Blogs on DLK2/EGFL9

There are no specific blogs for DLK2/EGFL9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DLK2/EGFL9 Antibody and receive a gift card or discount.


Gene Symbol DLK2