DIRAS3 Antibody


Immunocytochemistry/ Immunofluorescence: DIRAS3 Antibody [NBP1-90105] - Staining of human cell line U-251 MG shows localization to nuclear membrane & cytosol.
Immunohistochemistry-Paraffin: DIRAS3 Antibody [NBP1-90105] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

DIRAS3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLP
Specificity of human DIRAS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DIRAS3 Protein (NBP1-90105PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DIRAS3 Antibody

  • DIRAS family, GTP-binding RAS-like 3
  • Distinct subgroup of the Ras family member 3
  • NOEY2member I
  • RHOI
  • Rho-related GTP-binding protein RhoI


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IP, ICC, ICFlow, KO
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DIRAS3 Antibody (NBP1-90105) (0)

There are no publications for DIRAS3 Antibody (NBP1-90105).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIRAS3 Antibody (NBP1-90105) (0)

There are no reviews for DIRAS3 Antibody (NBP1-90105). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DIRAS3 Antibody (NBP1-90105) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for DIRAS3 Antibody (NBP1-90105)

Discover related pathways, diseases and genes to DIRAS3 Antibody (NBP1-90105). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIRAS3 Antibody (NBP1-90105)

Discover more about diseases related to DIRAS3 Antibody (NBP1-90105).

Pathways for DIRAS3 Antibody (NBP1-90105)

View related products by pathway.

PTMs for DIRAS3 Antibody (NBP1-90105)

Learn more about PTMs related to DIRAS3 Antibody (NBP1-90105).

Research Areas for DIRAS3 Antibody (NBP1-90105)

Find related products by research area.

Blogs on DIRAS3.

ULK1 - mammalian homologue of the yeast ATG1 kinase
Autophagy is an important cellular process involved in degradation and recycling of cellular macromolecules in response to stress or starvation. Autophagy is carried out in four main phases: phagophore nucleation, autophagosome elongation, docking...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DIRAS3 Antibody and receive a gift card or discount.


Gene Symbol DIRAS3