Recombinant Human DIO1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DIO1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-91 of Human DIO1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DIO1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DIO1 Protein

  • 5DI
  • deiodinase, iodothyronine, type I
  • DIOI
  • EC 1.97.1
  • EC 1.97.1.10
  • ITDI1
  • MGC130050
  • thyroxine deiodinase type I (selenoprotein)
  • TXDI1MGC130051
  • Type 1 DI
  • type I iodothyronine deiodinase
  • Type-I 5'-deiodinase

Background

The protein encoded by this gene is a thiol-requiring propylthiouracil-sensitive oxidoreductase. It activates thyroid hormone by converting the prohormone thyroxine (T4) by outer ring deiodination (ORD) to bioactive 3,3',5-triiodothyronine (T3). It also degrades both hormones by inner ring deiodination (IRD). Alternative splicing results in multiple transcript variants encoding different isoforms. Some, but not all, isoforms contain a selenocysteine (Sec) residue encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Additional transcript variants have been described but are not supported by experimental evidence. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
1670-SE
Species: Ec
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for DIO1 Partial Recombinant Protein (H00001733-Q01) (0)

There are no publications for DIO1 Partial Recombinant Protein (H00001733-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIO1 Partial Recombinant Protein (H00001733-Q01) (0)

There are no reviews for DIO1 Partial Recombinant Protein (H00001733-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DIO1 Partial Recombinant Protein (H00001733-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DIO1 Products

DIO1 H00001733-Q01

Bioinformatics Tool for DIO1 Partial Recombinant Protein (H00001733-Q01)

Discover related pathways, diseases and genes to DIO1 Partial Recombinant Protein (H00001733-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIO1 Partial Recombinant Protein (H00001733-Q01)

Discover more about diseases related to DIO1 Partial Recombinant Protein (H00001733-Q01).
 

Pathways for DIO1 Partial Recombinant Protein (H00001733-Q01)

View related products by pathway.

PTMs for DIO1 Partial Recombinant Protein (H00001733-Q01)

Learn more about PTMs related to DIO1 Partial Recombinant Protein (H00001733-Q01).

Blogs on DIO1

There are no specific blogs for DIO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DIO1 Antibody (1E4.)
H00001733-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DIO1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DIO1