DHX8 Antibody - BSA Free

Western Blot: DHX8 Antibody [NBP3-35462] - Western blot analysis of various lysates using DHX8 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DHX8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DHX8 Antibody - BSA Free (NBP3-35462) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1001-1220 of human DHX8 (NP_004932.1).
  
  Sequence:
  CSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DHX8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 139 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for DHX8 Antibody - BSA Free

• DDX8ATP-dependent RNA helicase DHX8
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 8 (RNA helicase)
• DEAH (Asp-Glu-Ala-His) box polypeptide 8
• DEAH box protein 8
• DEAH-box protein 8
• EC 3.6.1
• EC 3.6.4.13
• HRH1RNA helicase HRH1
• PRP22
• PRPF22

Background

DHX8 is a member of the DEAD box protein family, which is characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). The DEAD or DEAH motif is characteristic of a family of putative ATP-dependent RNA helicases. DHX8 has a role in nuclear export of spliced mRNA by releasing the RNA from the spliceosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DHX8