Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody

Images

 
Immunohistochemistry: Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody [NBP1-87547] - Staining of human smooth muscle shows moderate cytoplasmic positivity in muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRM3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Muscarinic Acetylcholine Receptor M3/CHRM3 Protein (NBP1-87547PEP)
Publications
Read Publication using
NBP1-87547 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24658304).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody

  • cholinergic receptor, muscarinic 3
  • CHRM3
  • HM3
  • m3 muscarinic receptor
  • mAChR M3
  • muscarinic acetylcholine receptor M3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB120-2805
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NLS220
Species: Hu, Rt, Po, Bv, Eq, GP, Ha
Applications: IHC-P
NBP1-87515
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
MAB4726
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-87578
Species: Hu
Applications: IHC, IHC-P
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-81029
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (NBP1-87547)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (NBP1-87547) (0)

There are no reviews for Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (NBP1-87547). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (NBP1-87547) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Muscarinic Acetylcholine Receptor M3/CHRM3 Products

Bioinformatics Tool for Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (NBP1-87547)

Discover related pathways, diseases and genes to Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (NBP1-87547). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (NBP1-87547)

Discover more about diseases related to Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (NBP1-87547).
 

Pathways for Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (NBP1-87547)

View related products by pathway.

PTMs for Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (NBP1-87547)

Learn more about PTMs related to Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (NBP1-87547).
 

Research Areas for Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (NBP1-87547)

Find related products by research area.

Blogs on Muscarinic Acetylcholine Receptor M3/CHRM3

There are no specific blogs for Muscarinic Acetylcholine Receptor M3/CHRM3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRM3
Entrez