DFF40/CAD Recombinant Protein Antigen

Images

 
There are currently no images for DFF40/CAD Recombinant Protein Antigen (NBP2-55648PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DFF40/CAD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DFF40/CAD.

Source: E. coli

Amino Acid Sequence: EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DFFB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55648.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DFF40/CAD Recombinant Protein Antigen

  • CAD
  • CADCaspase-activated nuclease
  • Caspase-activated deoxyribonuclease
  • Caspase-activated DNase
  • CPAN
  • CPANDNA fragmentation factor 40 kDa subunit
  • DFF2
  • DFF40
  • DFF-40DFF40DFF2DNA fragmentation factor subunit beta
  • DFFB
  • DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase)
  • EC 3.-

Background

Apoptosis is related to many diseases and induced by a family of cell death receptors and their ligands. Cell death signals are transduced by death domain containing adapter molecules and members of the caspase family of proteases. These death signals finally cause the degradation of chromosomal DNA by activated DNase. A mouse DNase that causes DNA fragmentation was identified recently and designated CAD (for caspase activated deoxyribonuclease). The human homologue of mouse CAD was more recently identified by two groups independently and termed CPAN and DFF40. Human DFF45 and its mouse homologue ICAD are the inhibitors of CPAN/DFF40 and CAD, respectively (1, 2, 5). Upon cleavage of DFF45/ICAD by activated caspase, DFF40/CAD is released and activated and eventually causes the degradation of DNA in the nuclei. Activation of CAD/DFF40, which causes DNA degradation, is the hallmark of apoptotic cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4679
Species: Hu
Applications: WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-44421
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-43728
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-76657
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB868
Species: Hu
Applications: WB
AF1457
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-55648PEP
Species: Hu
Applications: AC

Publications for DFF40/CAD Recombinant Protein Antigen (NBP2-55648PEP) (0)

There are no publications for DFF40/CAD Recombinant Protein Antigen (NBP2-55648PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DFF40/CAD Recombinant Protein Antigen (NBP2-55648PEP) (0)

There are no reviews for DFF40/CAD Recombinant Protein Antigen (NBP2-55648PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DFF40/CAD Recombinant Protein Antigen (NBP2-55648PEP). (Showing 1 - 1 of 1 FAQ).

  1. Does Novus offer any CAD (caspase activated DNase) antibodies that specifically look at the activation state of CAD? And if so, how well does this antibody work with chicken?
    • CAD/DFF40/DFFB is inhibited by being bound by DFFA. Because of this manner of inhibition, antibodies will not be able to recognize the difference between activated and inhibited DFFB, so we do not have a product specifically for activated or inhibited DFFB and this product will probably be nearly impossible to make. Unfortunately, the human and chicken sequence appear to be divergent for any of our immunogens to recommend any antibody to test for cross-reactivity with chicken. I apologize for the inconvenience.

Additional DFF40/CAD Products

Research Areas for DFF40/CAD Recombinant Protein Antigen (NBP2-55648PEP)

Find related products by research area.

Blogs on DFF40/CAD

There are no specific blogs for DFF40/CAD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DFF40/CAD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DFFB