Desmoglein-1 Antibody

Images

 
Immunohistochemistry-Paraffin: Desmoglein-1 Antibody [NBP1-84567] - Staining of human oral mucosa shows strong membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Desmoglein-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLQLSIGVRNKAEFHHSIMSQYKLKASAISVTVLNVIEGPVFRPGSKTYVVTGNMGSNDKVGDFVATDLDTGRPSTTVRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Desmoglein-1 Protein (NBP1-84567PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Desmoglein-1 Antibody

  • Cadherin family member 4
  • CDHF4
  • CDHF4PPKS1
  • desmoglein 1
  • Desmoglein1
  • Desmoglein-1
  • Desmosomal glycoprotein 1
  • DG1
  • DGI
  • DSG
  • DSG1
  • Pemphigus foliaceus antigen
  • SPPK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78984
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB7265
Species: Mu
Applications: WB, IHC
AF947
Species: Hu
Applications: WB, Simple Western
NBP1-88099
Species: Hu
Applications: Simple Western, IHC, IHC-P
AF7490
Species: Mu
Applications: IHC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
46780002
Species: Hu
Applications: ELISA
AF5725
Species: Hu
Applications: WB, IHC
NBP2-19775
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91800
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37557
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC

Publications for Desmoglein-1 Antibody (NBP1-84567) (0)

There are no publications for Desmoglein-1 Antibody (NBP1-84567).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Desmoglein-1 Antibody (NBP1-84567) (0)

There are no reviews for Desmoglein-1 Antibody (NBP1-84567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Desmoglein-1 Antibody (NBP1-84567). (Showing 1 - 1 of 1 FAQ).

  1. I need a specific antibody that targets the N-terminal part (extracellular) of Desmoglein 1 protein (Dsg1). Do you offer any such antibody?
    • I believe our product NBP1-84567 meets your requirements. The immunogenic peptide sequence is shown on the web page / datasheet for this antibody. UniProt tells me that the extracellular domain of Desmoglein 1 is residues 50-548. The immunogen for this antibody lies within this region (residues 344-478).

Secondary Antibodies

 

Isotype Controls

Additional Desmoglein-1 Products

Bioinformatics Tool for Desmoglein-1 Antibody (NBP1-84567)

Discover related pathways, diseases and genes to Desmoglein-1 Antibody (NBP1-84567). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Desmoglein-1 Antibody (NBP1-84567)

Discover more about diseases related to Desmoglein-1 Antibody (NBP1-84567).
 

Pathways for Desmoglein-1 Antibody (NBP1-84567)

View related products by pathway.

PTMs for Desmoglein-1 Antibody (NBP1-84567)

Learn more about PTMs related to Desmoglein-1 Antibody (NBP1-84567).

Blogs on Desmoglein-1

There are no specific blogs for Desmoglein-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Desmoglein-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSG1
Entrez