Recombinant Human Derlin 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Derlin 1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 134-233 of Human DERL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DERL1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Derlin 1 Protein

  • DER-1
  • DER1Degradation in endoplasmic reticulum protein 1
  • Der1-like domain family, member 1
  • Der1-like protein 1
  • derlin-1
  • DERtrin-1
  • FLJ13784
  • FLJ42092
  • MGC3067
  • PRO2577

Background

DERL1 - Der1-like domain family, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, KO
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-47485
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89558
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP2-16152
Species: Hu
Applications: WB
NBP1-81623
Species: Hu
Applications: IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
NBP2-46289
Species: Hu
Applications: WB, IHC
NBP1-84905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45970
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Derlin 1 Partial Recombinant Protein (H00079139-Q01) (0)

There are no publications for Derlin 1 Partial Recombinant Protein (H00079139-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Derlin 1 Partial Recombinant Protein (H00079139-Q01) (0)

There are no reviews for Derlin 1 Partial Recombinant Protein (H00079139-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Derlin 1 Partial Recombinant Protein (H00079139-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Derlin 1 Products

Bioinformatics Tool for Derlin 1 Partial Recombinant Protein (H00079139-Q01)

Discover related pathways, diseases and genes to Derlin 1 Partial Recombinant Protein (H00079139-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Derlin 1 Partial Recombinant Protein (H00079139-Q01)

Discover more about diseases related to Derlin 1 Partial Recombinant Protein (H00079139-Q01).
 

Pathways for Derlin 1 Partial Recombinant Protein (H00079139-Q01)

View related products by pathway.

PTMs for Derlin 1 Partial Recombinant Protein (H00079139-Q01)

Learn more about PTMs related to Derlin 1 Partial Recombinant Protein (H00079139-Q01).
 

Research Areas for Derlin 1 Partial Recombinant Protein (H00079139-Q01)

Find related products by research area.

Blogs on Derlin 1

There are no specific blogs for Derlin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Derlin 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DERL1