We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Deoxyguanosine kinase Recombinant Protein Antigen

Images

 
There are currently no images for Deoxyguanosine kinase Protein (NBP1-84256PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Deoxyguanosine kinase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DGUOK.

Source: E. coli

Amino Acid Sequence: STFVKLLTKTYPEWHVATEPVATWQNIQAAGTQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFPEKLLQARKPVQI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DGUOK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84256.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Deoxyguanosine kinase Recombinant Protein Antigen

  • deoxyguanosine kinase
  • deoxyguanosine kinase, mitochondrial
  • DGK
  • dGKmitochondrial deoxyguanosine kinase
  • EC 2.7.1.113
  • MTDPS3

Background

In mammalian cells, the phosphorylation of purine deoxyribonucleosides is mediated predominantly by two deoxyribonucleoside kinases, cytosolic deoxycytidine kinase and mitochondrial deoxyguanosine kinase. The protein encoded by this gene is responsible for phosphorylation of purine deoxyribonucleosides in the mitochondrial matrix. In addition, this protein phosphorylates several purine deoxyribonucleoside analogs used in the treatment of lymphoproliferative disorders, and this phosphorylation is critical for the effectiveness of the analogs. Alternative splice variants encoding different protein isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43639
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-20626
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KO, WB
NBP1-92505
Species: Hu
Applications:  IHC-P
AF6868
Species: Hu
Applications: IHC, KO, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC,  IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-85740
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP1-87769
Species: Hu
Applications: ICC/IF,  IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-55255
Species: Hu
Applications: IP, KD, Simple Western, WB
NBP2-13918
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for Deoxyguanosine kinase Protein (NBP1-84256PEP) (0)

There are no publications for Deoxyguanosine kinase Protein (NBP1-84256PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Deoxyguanosine kinase Protein (NBP1-84256PEP) (0)

There are no reviews for Deoxyguanosine kinase Protein (NBP1-84256PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Deoxyguanosine kinase Protein (NBP1-84256PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Deoxyguanosine kinase Products

Research Areas for Deoxyguanosine kinase Protein (NBP1-84256PEP)

Find related products by research area.

Blogs on Deoxyguanosine kinase

There are no specific blogs for Deoxyguanosine kinase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Deoxyguanosine kinase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DGUOK