Recombinant Human Deoxyguanosine kinase Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Deoxyguanosine kinase Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-89 of Human DGUOK partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIGLHCPKSWKLAGYDVPGASTMVLHIPDIFLFEPPESTAGALP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DGUOK
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Deoxyguanosine kinase Protein

  • deoxyguanosine kinase
  • deoxyguanosine kinase, mitochondrial
  • DGK
  • dGKmitochondrial deoxyguanosine kinase
  • EC 2.7.1.113
  • MTDPS3

Background

DGUOK - deoxyguanosine kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92505
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NBP2-13918
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001716-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Deoxyguanosine kinase Partial Recombinant Protein (H00001716-Q01) (0)

There are no publications for Deoxyguanosine kinase Partial Recombinant Protein (H00001716-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Deoxyguanosine kinase Partial Recombinant Protein (H00001716-Q01) (0)

There are no reviews for Deoxyguanosine kinase Partial Recombinant Protein (H00001716-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Deoxyguanosine kinase Partial Recombinant Protein (H00001716-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Deoxyguanosine kinase Products

Bioinformatics Tool for Deoxyguanosine kinase Partial Recombinant Protein (H00001716-Q01)

Discover related pathways, diseases and genes to Deoxyguanosine kinase Partial Recombinant Protein (H00001716-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Deoxyguanosine kinase Partial Recombinant Protein (H00001716-Q01)

Discover more about diseases related to Deoxyguanosine kinase Partial Recombinant Protein (H00001716-Q01).
 

Pathways for Deoxyguanosine kinase Partial Recombinant Protein (H00001716-Q01)

View related products by pathway.

PTMs for Deoxyguanosine kinase Partial Recombinant Protein (H00001716-Q01)

Learn more about PTMs related to Deoxyguanosine kinase Partial Recombinant Protein (H00001716-Q01).

Blogs on Deoxyguanosine kinase

There are no specific blogs for Deoxyguanosine kinase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Deoxyguanosine kinase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DGUOK