Dematin Antibody - BSA Free

Western Blot: Dematin Antibody [NBP2-84768] - Host: Rabbit. Target Name: DMTN. Sample Type: Hela Whole cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Dematin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Dematin Antibody - BSA Free (NBP2-84768) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human Dematin. Peptide sequence: KGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPB49
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Dematin Antibody - BSA Free

• dematin
• DMTFLJ78462
• erythrocyte membrane protein band 4.9 (dematin)
• Erythrocyte membrane protein band 4.9
• FLJ98848

Background

Caldesmon, filamin 1, nebulin, villin, plastin, ADF, gelsolin, Dematin, and cofilin are differentially expressed actin binding proteins. Dematin is a bundling protein of the erythrocyte membrane skeleton. Dematin is localized to the spectrin-actin junctions, and its actin-bundling activity is abolished upon phosphorylation by cAMP-dependent protein kinase. It may also play a role in the regulation of cell shape, implying a role in tumorigenesis. Dematin is a trimeric protein containing two subunits of 48 kDa and one subunit of 52 kDa. It is localized to the heart, brain, lung, skeletal muscle, and kidney. The Dematin gene is located on human chromosome 8p21.1, a region frequently deleted in prostate cancer, and mouse chromosome 14.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPB49