Recombinant Human delta 2 Catenin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human delta 2 Catenin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human CTNND2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CTNND2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human delta 2 Catenin Protein

  • catenin (cadherin-associated protein), delta 2 (neural plakophilin-relatedarm-repeat protein)
  • catenin delta-2
  • Delta-catenin
  • GT24T-cell delta-catenin
  • Neural plakophilin-related ARM-repeat protein
  • Neurojungin
  • NPRAPneurojungin

Background

CTNND2 - catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008502-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-59109
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP2-38999
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-74592
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB500-101
Species: Hu, Bv
Applications: WB, Flow, ICC/IF, IP
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00008877-M01
Species: Hu
Applications: WB, ELISA
H00001501-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for delta 2 Catenin Partial Recombinant Protein (H00001501-Q01) (0)

There are no publications for delta 2 Catenin Partial Recombinant Protein (H00001501-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for delta 2 Catenin Partial Recombinant Protein (H00001501-Q01) (0)

There are no reviews for delta 2 Catenin Partial Recombinant Protein (H00001501-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for delta 2 Catenin Partial Recombinant Protein (H00001501-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional delta 2 Catenin Products

Bioinformatics Tool for delta 2 Catenin Partial Recombinant Protein (H00001501-Q01)

Discover related pathways, diseases and genes to delta 2 Catenin Partial Recombinant Protein (H00001501-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for delta 2 Catenin Partial Recombinant Protein (H00001501-Q01)

Discover more about diseases related to delta 2 Catenin Partial Recombinant Protein (H00001501-Q01).
 

Pathways for delta 2 Catenin Partial Recombinant Protein (H00001501-Q01)

View related products by pathway.

PTMs for delta 2 Catenin Partial Recombinant Protein (H00001501-Q01)

Learn more about PTMs related to delta 2 Catenin Partial Recombinant Protein (H00001501-Q01).
 

Research Areas for delta 2 Catenin Partial Recombinant Protein (H00001501-Q01)

Find related products by research area.

Blogs on delta 2 Catenin

There are no specific blogs for delta 2 Catenin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CENPF Antibody
NB500-101

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human delta 2 Catenin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNND2