delta 2 Catenin Antibody

Images

 
Western Blot: delta 2 Catenin Antibody [H00001501-A01] - Analysis of CTNND2 expression in Hela S3 NE (Cat # L013V3 ).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

delta 2 Catenin Antibody Summary

Immunogen
CTNND2 (NP_001323 1081 a.a. - 1190 a.a.) partial recombinant protein with GST tag. ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLG
Specificity
CTNND2 - catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein)
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CTNND2
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for delta 2 Catenin Antibody

  • catenin (cadherin-associated protein), delta 2 (neural plakophilin-relatedarm-repeat protein)
  • catenin delta-2
  • Delta-catenin
  • GT24T-cell delta-catenin
  • Neural plakophilin-related ARM-repeat protein
  • Neurojungin
  • NPRAPneurojungin

Background

Armadillo-like proteins are characterized by a series of armadillo repeats, first defined in the Drosophila 'armadillo' gene product, that are typically 42 to 45 amino acids long. These proteins can be divided into subfamilies based on the number of repeats, their overall sequence similarity, and the dispersion of the repeats throughout their sequences. Members of the p120(ctn)/plakophilin subfamily of Armadillo-like proteins, including CTNND1 (MIM 601045), CTNND2, PKP1 (MIM 601975), PKP2 (MIM 602861), PKP4 (MIM 604276), and ARVCF (MIM 602269), have 10 armadillo repeats each (Bonne et al., 1998 [PubMed 9721216]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008502-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-59109
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP2-38999
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-74592
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB500-101
Species: Hu, Bv
Applications: WB, Flow, ICC/IF, IP
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00008877-M01
Species: Hu
Applications: WB, ELISA
H00001501-A01
Species: Hu
Applications: WB, ELISA

Publications for delta 2 Catenin Antibody (H00001501-A01) (0)

There are no publications for delta 2 Catenin Antibody (H00001501-A01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for delta 2 Catenin Antibody (H00001501-A01) (0)

There are no reviews for delta 2 Catenin Antibody (H00001501-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for delta 2 Catenin Antibody (H00001501-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional delta 2 Catenin Products

Bioinformatics Tool for delta 2 Catenin Antibody (H00001501-A01)

Discover related pathways, diseases and genes to delta 2 Catenin Antibody (H00001501-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for delta 2 Catenin Antibody (H00001501-A01)

Discover more about diseases related to delta 2 Catenin Antibody (H00001501-A01).
 

Pathways for delta 2 Catenin Antibody (H00001501-A01)

View related products by pathway.

PTMs for delta 2 Catenin Antibody (H00001501-A01)

Learn more about PTMs related to delta 2 Catenin Antibody (H00001501-A01).
 

Research Areas for delta 2 Catenin Antibody (H00001501-A01)

Find related products by research area.

Blogs on delta 2 Catenin

There are no specific blogs for delta 2 Catenin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our delta 2 Catenin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNND2
Entrez
OMIM
Uniprot