DEGS1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

DEGS1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DEGS1.

  Source: E. coli

  Amino Acid Sequence: YDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: DEGS1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57505.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DEGS1 Recombinant Protein Antigen

• Cell migration-inducing gene 15 protein
• Degenerative spermatocyte homolog 1
• degenerative spermatocyte homolog 1, lipid desaturase (Drosophila)
• degenerative spermatocyte homolog, lipid desaturase (Drosophila)
• DEGS
• DEGS1
• DES1
• Des-1
• DES1degenerative spermatocyte homolog, lipid desaturase
• EC 1.14
• EC 1.14.19.17
• EC 5.2.1.-
• FADS7
• membrane fatty acid (lipid) desaturase
• Membrane lipid desaturase
• MGC5079
• MIG15
• migration-inducing gene 15 protein
• MLDdihydroceramide desaturase
• Retinol isomerase
• sphingolipid delta 4 desaturase
• sphingolipid delta(4)-desaturase DES1

Background

DEGS1 encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: DEGS1