Defensin alpha 4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Defensin alpha 4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DEFA4.
  
  

  Source: E. coli

  Amino Acid Sequence: SSALQVSGSTRGMVCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: DEFA4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13910.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Defensin alpha 4 Recombinant Protein Antigen

• corticostatin
• DEF4
• defensin, alpha 4, corticostatin
• defensin, alpha 4, preproprotein
• HNP-4
• HP4
• HP-4
• MGC120099
• MGC138296
• neutrophil defensin 4

Background

Human neutrophil alpha-defensins (also designated HNPs) are small, cationic, cysteine-rich antimicrobial proteins that play important roles in innate immunity against infectious microbes such as bacteria, fungi and enveloped viruses. Alpha-defensins are synthesized as inactive precursors and are activated by proteolytic cleavage by MMP-7. Paneth cells in small intestinal crypts secrete the alpha-defensins, which are also termed cryptidins in mice. The cryptidin-4 gene is unique among the Paneth cell alpha defensins in that it is inactive in the duodenum, but expressed at maximal levels in the distal small bowel.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: DEFA4