Defensin alpha 3 Synthetic Peptide

Product Discontinued

Defensin alpha 3 Synthetic Peptide Summary

• Description: Sequence: DCYCRIPACIAGERRYGTCIYQGRLWAFCC
• Source: Synthetic
• Protein/Peptide Type: Synthetic Peptide
• Gene: DEFA3

Packaging, Storage & Formulations

• Storage: Store the unopened product at -20 °C. Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Storage below -20 °C is not recommended. Do not use past expiration date.
• Concentration: LYOPH
• Reconstitution Instructions: Reconstitute the vial by pipetting distilled or de-ionized water or DMSO (Caution: vial is under vacuum).

Alternate Names for Defensin alpha 3 Synthetic Peptide

• DEF3
• Defensin, alpha 3
• defensin, alpha 3, neutrophil-specific
• HNP3
• HNP-3defensin 3, neutrophil-specific
• HP3
• HP-3
• neutrophil defensin 3
• neutrophil peptide 3

Background

Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 3, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. It differs from defensin, alpha 1 by only one amino acid. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: DEFA3