Defensin alpha 3 Synthetic Peptide Summary
| Description |
Sequence: DCYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Source |
Synthetic |
| Protein/Peptide Type |
Synthetic Peptide |
| Gene |
DEFA3 |
Packaging, Storage & Formulations
| Storage |
Store the unopened product at -20 °C. Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Storage below -20 °C is not recommended. Do not use past expiration date. |
| Concentration |
LYOPH |
| Reconstitution Instructions |
Reconstitute the vial by pipetting distilled or de-ionized water or DMSO (Caution: vial is under vacuum). |
Alternate Names for Defensin alpha 3 Synthetic Peptide
Background
Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 3, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. It differs from defensin, alpha 1 by only one amino acid. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: Flow-IC, ICC/IF, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA, PAGE
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Publications for Defensin alpha 3 Protein (NBP2-62785) (0)
There are no publications for Defensin alpha 3 Protein (NBP2-62785).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Defensin alpha 3 Protein (NBP2-62785) (0)
There are no reviews for Defensin alpha 3 Protein (NBP2-62785).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Defensin alpha 3 Protein (NBP2-62785) (0)
Additional Defensin alpha 3 Products
Blogs on Defensin alpha 3