Recombinant Human DEF6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DEF6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-336 of Human DEF6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQR

Protein/Peptide Type
Recombinant Protein
Gene
DEF6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
No additives

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DEF6 Protein

  • DEF-6
  • differentially expressed in FDCP 6 homolog (mouse)
  • differentially expressed in FDCP 6 homolog
  • IBPdifferentially expressed in FDCP (mouse homolog) 6
  • IRF4-binding protein
  • SLAT
  • SWAP70L
  • SWAP-70-like adaptor protein of T cells

Background

DEF6( AAH17504, 1 a.a. - 337 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82979
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
594-ML/CF
Species: Mu
AF5525
Species: Hu
Applications: WB, IHC
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-82018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC

Publications for DEF6 Recombinant Protein (H00050619-P01) (0)

There are no publications for DEF6 Recombinant Protein (H00050619-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DEF6 Recombinant Protein (H00050619-P01) (0)

There are no reviews for DEF6 Recombinant Protein (H00050619-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DEF6 Recombinant Protein (H00050619-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DEF6 Products

Bioinformatics Tool for DEF6 Recombinant Protein (H00050619-P01)

Discover related pathways, diseases and genes to DEF6 Recombinant Protein (H00050619-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DEF6 Recombinant Protein (H00050619-P01)

Discover more about diseases related to DEF6 Recombinant Protein (H00050619-P01).
 

Pathways for DEF6 Recombinant Protein (H00050619-P01)

View related products by pathway.

PTMs for DEF6 Recombinant Protein (H00050619-P01)

Learn more about PTMs related to DEF6 Recombinant Protein (H00050619-P01).

Blogs on DEF6

There are no specific blogs for DEF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DEF6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DEF6