Home » DEF6 » DEF6 Proteins » DEF6 Recombinant Protein Antigen

DEF6 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DEF6 Protein (NBP1-81618PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

DEF6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DEF6.

Source: E.coli

Amino Acid Sequence: RADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGG
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DEF6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81618.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for DEF6 Recombinant Protein Antigen

  • DEF-6
  • differentially expressed in FDCP 6 homolog (mouse)
  • differentially expressed in FDCP 6 homolog
  • IBPdifferentially expressed in FDCP (mouse homolog) 6
  • IRF4-binding protein
  • SLAT
  • SWAP70L
  • SWAP-70-like adaptor protein of T cells

Background

DEF6, or IBP, is a guanine nucleotide exchange factor (GEF) for RAC (MIM 602048) and CDC42 (MIM 116952) that is highly expressed in B and T cells (Gupta et al., 2003 [PubMed 12923183]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SWAP70 Antibody
NBP1-82979
Western Blot: SWAP70 Antibody [NBP1-82979] - Analysis in human cell lines A-431 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western Blot: SWAP70 Antibody [NBP1-82979] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: SWAP70 Antibody [NBP1-82979] - Human dendritic cells were pulsed with FITC-labeled zymosan (zymosan-FITC; green in merge)(pink arrowheads) and latex beads (yellow arrowhead) followed by immunostaining for SWAP70 (magenta). Scale bars, 10 um. Image from a verified customer review.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SOS2 Antibody
[Unconjugated]
AF6260
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and 293T human embryonic kidney cell line. PVDF Membrane was probed with 2 µg/mL of Goat Anti-Human SOS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6260) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for SOS2 at approximately 160 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
SOS1 Antibody
(SOS-01) - BSA Free
NB110-68800
Western Blot: SOS1 Antibody (SOS-01) [NB110-68800] - Analysis (reducing conditions) of human Sos using anti-human Sos (SOS-1). Lane 1: K562 human Caucasian chronic myeloid leukemia cell line Lane 2: RAJI human Burkitt lymphoma cell line
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in human primary fibroblasts using anti-Sos (SOS-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in murine transformed fibroblasts using anti-Sos (SOS-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Species: Hu, Mu
Applications: ICC/IF, WB
RASGRF1 Antibody
NBP1-85727
Immunohistochemistry-Paraffin: RASGRF1 Antibody [NBP1-85727] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: RASGRF1 Antibody [NBP1-85727] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & the Golgi apparatus. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen: Rhodopsin Antibody (4D2) [NBP2-59690] - Zebrafish retina (outer nuclear layer). PFA and methanol fixed 7 um sections. Rhodopsin antibody O/N incubation at 1:500. IHC-Fr image submitted by a verified customer review.
Western Blot: Rhodopsin Antibody (4D2) [NBP2-59690] - Western Blot analysis of Bovine photoreceptor membranes showing detection of Rhodopsin protein using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 4D2 (NBP2-59690). Lane 1: MW ladder. Lane 2: 10 ug. Lane 3: 5 ug. Lane 4: 2.5 ug.. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody (NBP2-59690) at 1:1000.
Immunohistochemistry: Rhodopsin Antibody (4D2) [NBP2-59690] - Immunohistochemistry analysis using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 4D2 (NBP2-59690). Tissue: retina. Species: Mouse. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody (NBP2-59690) at 1:1000. Secondary Antibody: FITC Goat Anti-Mouse (green). Counterstain: DAPI (blue) nuclear stain. Localization: Staining of photoreceptor outer segment (OS). Other layers of the retina: IS inner segment; ONL outer nuclear layer; OPL outer plexiform layer; INL inner nuclear layer; IPL inner plexiform layer; GCL ganglion cell layer..
(1 Review)
(3 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
RhoD Antibody
NBP1-58359
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X.
Species: Hu
Applications: IHC, IHC-P, WB
PBR Antibody
NB100-41398
Flow Cytometry: PBR Antibody [NB100-41398] - Flow cytometric analysis of paraformaldehyde fixed MCF7 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunocytochemistry/Immunofluorescence: PBR Antibody [NB100-41398] - Immunofluorescence analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative cLontrol: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody.
Immunocytochemistry/Immunofluorescence: PBR Antibody [NB100-41398] - Immunofluorescence analysis of paraformaldehyde fixed MCF7 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(12 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Rac1 Antibody
NB100-91266
Western Blot: Rac1 Antibody [NB100-91266] - WB on tissue lysates. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution: 1:1000 incubated overnight at 4C.
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat spinal cord (ventral horn) using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat ligated sciatic nerve using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
GEF-H1 Antibody
NBP2-21577
Western Blot: GEF-H1 Antibody [NBP2-21577] - A. 30 ug 293T whole cell lysate/extract B. 30 ug A431 whole cell lysate/extract C. 30 ug HeLa whole cell lysate/extract D. 30 ug HepG2 whole cell lysate/extract5% SDS-PAGE GEF-H1 antibody dilution: 1:2000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: GEF-H1 Antibody [NBP2-21577] - A. 30 ug Neuro2A whole cell lysate/extract B. 30 ug GL261 whole cell lysate/extract C. 30 ug C8D30 whole cell lysate/extract D. 30 ug NIH-3T3 whole cell lysate/extract E. 30 ug BCL-1 whole cell lysate/extract F. 30 ug Raw 264.7 whole cell lysate/extract G. 30 ug C2Cl2 whole cell lysate/extract 5% SDS-PAGEGEF-H1 antibody dilution: 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: GEF-H1 Antibody [NBP2-21577] - A. 30 ug 293T whole cell lysate/extract B. 30 ug A431 whole cell lysate/extract C. 30 ug HeLa whole cell lysate/extract D. 30 ug HepG2 whole cell lysate/extract5% SDS-PAGE GEF-H1 antibody dilution: 1:2000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
SLC2A4RG Antibody
(4C10)
H00056731-M02
Western Blot: SLC2A4RG Antibody (4C10) [H00056731-M02] - SLC2A4RG monoclonal antibody (M02), clone 4C10 Analysis of SLC2A4RG expression in HeLa.
Immunocytochemistry/Immunofluorescence: SLC2A4RG Antibody (4C10) [H00056731-M02] - Analysis of monoclonal antibody to SLC2A4RG on HeLa cell. Antibody concentration 10 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, WB
IL-21
[Unconjugated]
594-ML/CF
1 μg/lane of Recombinant Mouse IL-21 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 15 kDa.
Recombinant Mouse IL-21 (Catalog # 594‑ML/CF) enhance IFN-gamma secretion in NK-92 human natural killer lymphoma cells. The ED50 is ≤8 ng/mL.
(41 Publications)
Species: Mu
Applications: BA
IRF4 Antibody
AF5525
IRF4 was detected in immersion fixed paraffin-embedded sections of human tonsil using Sheep Anti-Human IRF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5525) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm of lymphocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of Ramos human Burkitt's lymphoma cell line, Raji human Burkitt's lymphoma cell line, and RPMI 8226 human multiple myeloma cell line. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human IRF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5525) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for IRF4 at approximately 53 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(1 Publication)
Species: Hu
Applications: IHC, WB
CDC42 Antibody
NBP2-68888
Western Blot: CDC42 Antibody [NBP2-68888] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: CDC42 Antibody [NBP2-68888] - Staining of human spleen shows cytoplasmic positivity in red pulp.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(28 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Progesterone R/NR3C3 was detected in immersion fixed T47D human breast cancer cell line using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 1.7 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Progesterone R/NR3C3 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of T47D human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) followed by HRP‑conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for PR-A and PR-B at approximately 90 and 118 kDa, respectively (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(4 Reviews)
(349 Publications)
Species: Hu
Applications: BA
DCP1B Antibody
NBP1-82018
Western Blot: DCP1B Antibody [NBP1-82018] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: DCP1B Antibody [NBP1-82018] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: DCP1B Antibody [NBP1-82018] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - FFPE tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, ACD catalog # 311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog # NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Immunofluorescent staining of TMAs. Representative tissue cores from normal (I), adenomatous polyps (II), and CRC (III and IV) are shown. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Pericryptal Myofibroblasts are Responsible for Increased TLR4 Expression in a Subset of CRCs. Double-stained immunofluorescence for TLR4 (green) and vimentin (red) in normal (I), adenoma (II), and colon adenocarcinoma (III) (10x). In the stromal compartment of CRCs, immunofluorescent staining for TLR4 localized to the pericryptal myofibroblasts in a subset of samples. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
(5 Reviews)
(122 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB

Publications for DEF6 Protein (NBP1-81618PEP) (0)

There are no publications for DEF6 Protein (NBP1-81618PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DEF6 Protein (NBP1-81618PEP) (0)

There are no reviews for DEF6 Protein (NBP1-81618PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DEF6 Protein (NBP1-81618PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DEF6 Products

Bioinformatics Tool for DEF6 Protein (NBP1-81618PEP)

Discover related pathways, diseases and genes to DEF6 Protein (NBP1-81618PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DEF6 Protein (NBP1-81618PEP)

Discover more about diseases related to DEF6 Protein (NBP1-81618PEP).
 

Pathways for DEF6 Protein (NBP1-81618PEP)

View related products by pathway.

PTMs for DEF6 Protein (NBP1-81618PEP)

Learn more about PTMs related to DEF6 Protein (NBP1-81618PEP).

Blogs on DEF6

There are no specific blogs for DEF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
IL-2 [Unconjugated]
202-IL-010
Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - FFPE tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, ACD catalog # 311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog # NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
TLR4 Antibody (76B357.1) - BSA Free
NB100-56566

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DEF6 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DEF6