Death Ligand Signal Enhancer Antibody

Images

 
Immunohistochemistry-Paraffin: Death Ligand Signal Enhancer Antibody [NBP1-84278] - Staining of human kidney shows strong nuclear positivity in cells of tubules and glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Death Ligand Signal Enhancer Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PLDRFFSSPLWHPCSSLRQHILPSPDGPAPRHTGLREPRLGQEEASAQPRNFSHNSLRGARPQDPSEEGPGDFGFLHASSSIESEAKPAQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA0141
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Death Ligand Signal Enhancer Protein (NBP1-84278PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Death Ligand Signal Enhancer Antibody

  • hypothetical protein LOC9812
  • KIAA0141

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-88420
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
NBP1-84278
Species: Hu
Applications: IHC, IHC-P

Publications for Death Ligand Signal Enhancer Antibody (NBP1-84278) (0)

There are no publications for Death Ligand Signal Enhancer Antibody (NBP1-84278).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Death Ligand Signal Enhancer Antibody (NBP1-84278) (0)

There are no reviews for Death Ligand Signal Enhancer Antibody (NBP1-84278). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Death Ligand Signal Enhancer Antibody (NBP1-84278) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Death Ligand Signal Enhancer Products

Bioinformatics Tool for Death Ligand Signal Enhancer Antibody (NBP1-84278)

Discover related pathways, diseases and genes to Death Ligand Signal Enhancer Antibody (NBP1-84278). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Death Ligand Signal Enhancer

There are no specific blogs for Death Ligand Signal Enhancer, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Death Ligand Signal Enhancer Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA0141