Death Ligand Signal Enhancer Antibody

Immunohistochemistry-Paraffin: Death Ligand Signal Enhancer Antibody [NBP1-84278] - Staining of human kidney shows strong nuclear positivity in cells of tubules and glomeruli.

Product Discontinued

Death Ligand Signal Enhancer Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PLDRFFSSPLWHPCSSLRQHILPSPDGPAPRHTGLREPRLGQEEASAQPRNFSHNSLRGARPQDPSEEGPGDFGFLHASSSIESEAKPAQP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIAA0141
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Death Ligand Signal Enhancer Antibody

• DAP3 Binding Cell Death Enhancer 1
• DAP3-Binding Cell Death Enhancer 1
• DAP3-Binding Cell Death Enhancer 1, Long Form
• Death Ligand Signal Enhancer
• DELE
• DELE1
• DELE1(L)
• hypothetical protein LOC9812
• KIAA0141

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIAA0141