DDX46 Recombinant Protein Antigen (NBP2-56227PEP)

Images

 
There are currently no images for DDX46 Recombinant Protein Antigen (NBP2-56227PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DDX46 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DDX46.

Source: E.coli

Amino Acid Sequence: SKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCK

Protein/Peptide Type
Recombinant Protein Antigen
Gene
DDX46
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-56227 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DDX46 Recombinant Protein Antigen

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
  • DEAD box protein 46
  • EC 3.6.1
  • EC 3.6.4.13
  • FLJ25329
  • KIAA0801probable ATP-dependent RNA helicase DDX46
  • MGC9936
  • PRP5 homolog
  • Prp5
  • Prp5-like DEAD-box protein
  • PRPF5
  • RNA helicase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008175-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-79843
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NBP1-87133
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88854
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82999
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31354
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00079092-T01
Species: Hu
NBP2-47274
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-83217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-85720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1618
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56227PEP
Species: Hu
Applications: AC

Publications for DDX46 Recombinant Protein Antigen (NBP2-56227PEP) (0)

There are no publications for DDX46 Recombinant Protein Antigen (NBP2-56227PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX46 Recombinant Protein Antigen (NBP2-56227PEP) (0)

There are no reviews for DDX46 Recombinant Protein Antigen (NBP2-56227PEP). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for DDX46 Recombinant Protein Antigen (NBP2-56227PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DDX46 Products

Related Products by Gene

Bioinformatics Tool for DDX46 Recombinant Protein Antigen (NBP2-56227PEP)

Discover related pathways, diseases and genes to DDX46 Recombinant Protein Antigen (NBP2-56227PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX46 Recombinant Protein Antigen (NBP2-56227PEP)

Discover more about diseases related to DDX46 Recombinant Protein Antigen (NBP2-56227PEP).
 

Pathways for DDX46 Recombinant Protein Antigen (NBP2-56227PEP)

View related products by pathway.

PTMs for DDX46 Recombinant Protein Antigen (NBP2-56227PEP)

Learn more about PTMs related to DDX46 Recombinant Protein Antigen (NBP2-56227PEP).

Blogs on DDX46

There are no specific blogs for DDX46, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DDX46 Antibody
NBP1-83565
DDX46 Antibody
NBP1-83565
DDX46 Antibody
NBP1-83565
SF3B2 Antibody
NB100-79848
SF3B2 Antibody
NB100-79848

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DDX46 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX46