We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DDX46 Recombinant Protein Antigen

Images

 
There are currently no images for DDX46 Recombinant Protein Antigen (NBP2-56227PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DDX46 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DDX46.

Source: E. coli

Amino Acid Sequence: SKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DDX46
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56227.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DDX46 Recombinant Protein Antigen

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
  • DEAD box protein 46
  • EC 3.6.1
  • EC 3.6.4.13
  • FLJ25329
  • KIAA0801probable ATP-dependent RNA helicase DDX46
  • MGC9936
  • PRP5 homolog
  • Prp5
  • Prp5-like DEAD-box protein
  • PRPF5
  • RNA helicase

Background

DDX46 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a component of the 17S U2 snRNP complex; it plays an important role in pre-mRNA splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47281
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87214
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB100-122
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
NB100-79848
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87135
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88829
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-82999
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-35253
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-94076
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-92873
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-47274
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83218
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-85720
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-83304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-56227PEP
Species: Hu
Applications: AC

Publications for DDX46 Recombinant Protein Antigen (NBP2-56227PEP) (0)

There are no publications for DDX46 Recombinant Protein Antigen (NBP2-56227PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX46 Recombinant Protein Antigen (NBP2-56227PEP) (0)

There are no reviews for DDX46 Recombinant Protein Antigen (NBP2-56227PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DDX46 Recombinant Protein Antigen (NBP2-56227PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DDX46 Products

Blogs on DDX46

There are no specific blogs for DDX46, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DDX46 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX46