DDX27 Recombinant Protein Antigen

Images

 
There are currently no images for DDX27 Protein (NBP1-91825PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DDX27 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DDX27.

Source: E.coli

Amino Acid Sequence: EDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSEDEASETDYSSADENILTKADTLKVKDRKKKKKKGQEAGVFFEDASQYDENLSFQ

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DDX27
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-91825.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for DDX27 Recombinant Protein Antigen

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 27
  • DEAD box protein 27
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 27
  • dJ686N3.1
  • DKFZp667N057
  • DRS1
  • EC 3.6.1
  • EC 3.6.4.13
  • FLJ12917
  • FLJ20596
  • FLJ22238
  • MGC1018
  • MGC163147
  • PP3241
  • probable ATP-dependent RNA helicase DDX27
  • RHLP
  • RNA helicase-like protein
  • Rrp3p

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P, KD
NBP1-87134
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65592
Species: Hu
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86872
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00051428-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-57100
Species: Hu
Applications: ICC/IF
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC

Publications for DDX27 Protein (NBP1-91825PEP) (0)

There are no publications for DDX27 Protein (NBP1-91825PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX27 Protein (NBP1-91825PEP) (0)

There are no reviews for DDX27 Protein (NBP1-91825PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for DDX27 Protein (NBP1-91825PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for DDX27 Protein (NBP1-91825PEP)

Discover related pathways, diseases and genes to DDX27 Protein (NBP1-91825PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX27 Protein (NBP1-91825PEP)

Discover more about diseases related to DDX27 Protein (NBP1-91825PEP).

Blogs on DDX27

There are no specific blogs for DDX27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DDX27 Antibody
NBP1-91825
eIF4G1 Antibody
NB100-268

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DDX27 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX27